CAZyme Information: RVD80126.1

Basic Information

• Species: Arthrobotrys flagrans
• Lineage: Ascomycota; Orbiliomycetes; ; Orbiliaceae; Arthrobotrys; Arthrobotrys flagrans
• CAZyme ID: RVD80126.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	SAEB01000012|CGC5	34267.96	9.2159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflagransCBSH-5679	9927	N/A	30	9897

• Gene Location: location=SAEB01000012:241774-242855(-)

Full Sequence      

MKLLNAIGTLAAAMMLLPAQTLAGQYKGFSMGANKADGGCKTQTDWRIDFQTIKGWGKGF
NAARLYASSDCNTIMRAAAAAKDVGFKILVGVWATDDLHFNNEKQALEAAIRTHGWDWIA
GISVGSEDLYRRDITPQKLATQIYDVRGMVRYLTQNAKIPVGHTDTWTAWVDGANDEVTR
ASDVVITNGFPYWQGVPIRDAIKAKTFQWSYWDTKRRVEQINPNAMVWVGETGWPTRGPN
YPNPAGGGAAPATTNLKNYYTSVACWLWPKPDVSAFWFTAFDAPKANPEVEKWFGIADSN
RKLKFALPC

Enzyme Prediction     

No EC number prediction in RVD80126.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	59	309	4e-24	0.9163987138263665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.78e-59	27	301	46	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.04e-16	61	309	38	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX45311.1|GH17	1.13e-218	1	309	1	309
UPK92387.1|GH17	1.94e-153	1	309	1	302
QKD61100.1|GH17	5.56e-153	1	309	1	302
CCT74252.1|GH17	2.62e-151	1	309	1	302
QGI87033.1|GH17	2.62e-151	1	309	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.80e-26	26	304	37	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.29e-25	26	304	37	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	1.35e-55	29	309	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	1.38e-49	1	309	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	2.17e-42	29	309	24	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	6.45e-41	29	309	24	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|D4B2W4|BGL2_ARTBC	1.45e-38	10	309	7	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000385	0.999571	CS pos: 23-24. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in RVD80126.1.