CAZyme Information: RQM18564.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM18564.1
• CAZy Family: GT71
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A3M6VHA7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1245		139301.14	4.6882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000043:56822-60559(-)

Full Sequence      

MTDSSSFKDREAALLRELSALYTKLNQVRDKRVKEEQESSAGGGNDKDGDDEGVKGSRRR
RRVLLVTRTLPFWLVSEDAQSQWRAEFPEHASLNGAMEIFQSLHESYDCVWIGSVHGEIE
PSEQNTLKEQLLQDRKYYPVFLDERRERLYYQGFCKTVMWPLFHSCPPTTDDQITQHEMM
EDGQEDDHSMEKMWQAYVAANQAFADAIQEVYEEGDLVWIQGYHLTLVPQMVQNLFPNNN
VCMGFFMHIPFPSAELYRILNNREEILTGILGADLIGFQTYEYARHFQSACVRLLGLESS
HEGVDLNGHFARVTICPVGIDANKYAAMVQSDAVQKQMTQLTSQFSGKKVILGVDQLDQT
KGLVHKLLAVEELFTQKPDLAKKVVFLQIVTGPPVYESALESQVESLVSRINSKLQDVGT
EGPVQYLNKDIAVEALLALYALADALVITPVRDGMNTIPFGYIVCREATNKHARVILSEF
AGCAQSLGKARLANPWNTEELSRALLESLQDNDEVMRAHEHMFSYVSSFTSRHWADKFLE
QLHECREENAVSVSGRELSRRDMTSAYSRSSRRLIFINYEGVLAVEASIPELAYPPQELI
WQLSMLTSDPRNTVVLVSARSMSVCEQWFAELSGNLVLAAEYGVYVKWIGDNEGWHCLVP
NMDMSWWEHILPLLEYYTERTPGAYIERKDSSIAWHYRDCDLDHGLWQASELLVSLREIT
RSLPVSLYPGNRYLEVRPEKVSKATLFERIWKYMNWSSLFPDEDPVTTEYLGELIHPPPS
STVISRGFENDVPGGDGLTALSLDDLNTRLTRKDFLRGDRKDSESFSIEQPDDADEKQPV
DFILVIASGDDRTDEDVFAFLVPPPIDLDAYSRQLEKDDISSTPQQVEGLLPAEPDTDDS
SFSSNRHLSFIQEAGCSESEIGSSSFDDISDNMSYKTSRRLRGRTSLAAGSCGERGSLST
TSSLARLSSLPGVADSRALDENITKLTLANSPNAEEAGNMFPMLNRKIVARHDGIVTEKS
RFTRPDFPPSAALFKAMRAKYGENFGLHRIPDTLAACWALVCPPNGCAKVEDGIKTQRSN
SRVLPEEKLLVTGNLVTTEGLEASAGGDSSGNSWVHSGLTALKSTAIRDSEDDSGSLRGD
GDQAQCNNKDKSDSNIAEKELTAEKATGENELPVSQTTSGSTDEADDGRYRFPVNTFVCT
LGRKHSQAPYFIKNSGDLFQLLQEMGMSSHIRKQRVLSTGSVGDI

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	58	543	2.4e-145	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	2.29e-172	102	783	36	697	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	2.72e-152	102	543	36	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.19e-140	86	544	23	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	3.62e-139	107	750	134	776	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	3.73e-138	105	750	49	686	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28038.1|GT20	0.0	1	1245	1	1245
CCA15235.1|GT20	0.0	8	1238	28	1218
QOX06485.1|GT20	3.01e-154	63	755	77	755
AJA04606.1|GT20	3.15e-148	63	750	130	806
AGT80036.1|GT20	3.15e-148	63	750	130	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	8.87e-93	63	557	14	489	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.37e-90	63	551	6	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.89e-90	63	551	6	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.49e-87	63	543	2	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.24e-87	63	545	13	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	2.37e-139	63	750	18	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	2.53e-135	76	783	62	758	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9LRA7|TPS9_ARATH	4.23e-125	64	750	62	765	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	9.69e-125	63	750	94	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q0WUI9|TPS8_ARATH	1.67e-124	64	754	60	764	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000035

TMHMM  Annotations     

There is no transmembrane helices in RQM18564.1.