CAZyme Information: RQM17372.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM17372.1
• CAZy Family: GT49
• CAZyme Description: Pectinesterase [Source:UniProtKB/TrEMBL;Acc:A0A3R7XYZ8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	QKXF01000097|CGC1	36123.76	6.3708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000097:2698-3693(+)

Full Sequence      

MRMFALPVILLASLVVGADAACTNPPAGAIIVDQSGHHSGYLTIKDAVNNLDLSTTVQQT
IFIYKGTYQEQVVISKLKGTLVLQGYTCDKMSYDKNEVTITHQMSQQDLSPHHSGSANDL
VSTLRIDTDNVQVYNLNFVNTAVPTPQNGQAPALSVACKQCAFYVCTITGHQDTLFANRG
YQFYGRSHVVGTVDFIFGNARAWFQSCDIESVGPGYITANGRGSEDDNSYFVLNKARVSS
LSPGKVYLGRPWGKYARVVFQQCDLGGNINAAGWIPMYEDMGTSNVFLKEYKDANTTIDG
RVPYSGQLDGPIAISTILGKDFATFVNKDYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	307	1.2e-68	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	8.39e-46	30	306	2	276	Pectinesterase.
215114	PLN02170	6.68e-40	26	306	225	492	probable pectinesterase/pectinesterase inhibitor
178504	PLN02916	7.11e-39	33	306	194	466	pectinesterase family protein
215170	PLN02301	2.36e-38	30	291	238	495	pectinesterase/pectinesterase inhibitor
178098	PLN02480	4.64e-38	30	308	50	319	Probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22416.1|CE8	1.95e-246	1	331	1	331
UIZ22417.1|CE8	1.10e-210	1	331	1	327
UIZ22415.1|CE8	4.11e-206	1	331	1	327
UIZ22413.1|CE8	3.90e-194	1	331	1	333
ABQ63096.1|CE8	1.36e-101	1	331	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	9.73e-50	23	330	4	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.37e-49	23	330	4	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.16e-32	23	306	4	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.82e-28	31	291	6	262	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.27e-11	39	306	46	327	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	6.24e-72	20	330	18	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	9.87e-68	10	331	5	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	4.84e-60	19	330	25	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	3.81e-59	19	330	25	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.34e-57	23	330	29	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999760	CS pos: 20-21. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in RQM17372.1.