CAZyme Information: RQM16933.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM16933.1
• CAZy Family: GT43
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A3M6VLU7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	QKXF01000106|CGC1	49563.34	8.8808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000106:34692-36080(-)

Full Sequence      

MIRMYERSVVTFAVVTRAWVTLVAVSTACIVTPYDTSSHLQADGSLLAALSNWDGVYFSH
IALHGYDFEHFHAFFPLYPLLMRWFAHFLPLEDKSAVIASGWIISNVSFVLAALFLYRLG
CIVIGDEIIARRAAYLFCVTPSSIFMSSVYSESLMCLLSFSGMYFLAKHAQTPKPRRTFC
DLVYCALLFGAASATRSNGILLSLFIAWHRVTVSPPPREMVRFFGFWIRTAALGVLAVAP
QIMYFVTSMMPYCPLLVKHLGGEVSGSNEMEDRSWCAMAVPNVFAMYTFIQSEYWNVGLF
RYYELNQLPNFLLAAPIIALSVHALHGYFRGTIVPGRPRVILQQERGKSGWRGTALTPYY
AHWLFLIVNALLVVHIQVTTRLLCACPPLFWHPASLLCDSTITRKASPVMTRYGRVIVTY
FLLFTVLGSVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in RQM16933.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	9	439	4.2e-106	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.16e-53	9	439	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.05e-15	50	325	71	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	0.0	1	439	1	439
CCA18790.1|GT76	6.92e-121	6	439	6	490
ACO67127.1|GT76	9.61e-63	30	439	26	421
CAG1859610.1|GT76	3.43e-56	6	439	11	505
BBN03197.1|GT76	1.12e-55	53	439	84	482

PDB Hits     

RQM16933.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TPN3|PIGV_MOUSE	4.04e-43	46	439	59	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q5KR61|PIGV_RAT	1.06e-42	45	439	58	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q9NUD9|PIGV_HUMAN	7.07e-40	46	439	59	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.20e-37	34	437	47	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q290J8|PIGV_DROPS	1.65e-36	47	439	60	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.098547	0.901453	CS pos: 28-29. Pr: 0.8559

TMHMM  Annotations     

Start	End
12	34
98	120
133	155
183	205
225	247
277	299
312	334
354	376
416	438