CAZyme Information: RQM16519.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM16519.1
• CAZy Family: GT71|GT71
• CAZyme Description: AMPKBI domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A3R7XY50]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	QKXF01000114|CGC1	35082.76	4.6483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000114:70433-71468(+)

Full Sequence      

MGSASSKTGDVNPKNLGADPNDPNAFPVHHHPYYSNQPGHGQTQQGGGYDNIEDGKYSLP
RQQYYGQEQDHTEAMDVDLPTDSTSDMDGEMDSSLQLDVKDTDNSKGKNIQASDATLPPR
EDVVPMVFKWEHGGRNVFITGTFNGWDKQCPMHRSGNDFTYIANLTRGKHMYKFVVDDDW
RFAPDQLTMADVEGNVNNYVDVSEFAPLSDFDGKNKLQEDDEDPENPYSRYIPEIDEYTK
EPPPLPPHLRHIILNKAPPTVDGRLLPVPQHVALNHLYCTAIKDGMMVLGITNRYKQKFV
TTVYYSLMPGAN

Enzyme Prediction     

No EC number prediction in RQM16519.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.13e-40	124	212	1	85	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199889	E_set_AMPKbeta_like_N	8.10e-29	125	202	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
398422	AMPKBI	2.82e-27	248	306	9	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
214973	AMPKBI	6.82e-22	223	306	2	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199885	E_set_GBE_prok_N	1.69e-04	135	178	31	77	N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme. This subfamily is composed of predominantly prokaryotic 1,4 alpha glucan branching enzymes, also called glycogen branching enzymes. E or "early" set domains are associated with the catalytic domain of glycogen branching enzymes at the N-terminal end. Glycogen branching enzyme catalyzes the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage, yielding a non-reducing end oligosaccharide chain, as well as the subsequent attachment of short glucosyl chains to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. The N-terminal domain of the 1,4 alpha glucan branching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25814.1|CBM48	7.25e-237	1	312	1	312
CCA27392.1|CBM48	2.88e-114	94	312	95	327
CCA26507.1|CBM48	2.01e-108	94	312	570	802
AFO97445.1|CBM48	6.83e-44	125	305	83	272
ALC42017.1|CBM48	1.91e-43	109	305	128	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T5T_B	3.38e-42	125	305	13	201	AMPK bound to allosteric activator [Rattus norvegicus]
4QFG_B	3.38e-42	125	305	13	201	Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator [Rattus norvegicus],4QFR_B Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor [Rattus norvegicus],4QFS_B Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor [Rattus norvegicus],5KQ5_B AMPK bound to allosteric activator [Rattus norvegicus],5UFU_B Structure of AMPK bound to activator [Rattus norvegicus]
6E4T_B	4.75e-42	125	305	13	201	Structure of AMPK bound to activator [Rattus norvegicus],6E4U_B Structure of AMPK bound to activator [Rattus norvegicus],6E4W_B Structure of AMPK bound to activator [Rattus norvegicus]
4REW_B	1.53e-41	125	305	3	194	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
6C9F_B	2.63e-41	125	305	13	201	AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9G_B AMP-activated protein kinase bound to pharmacological activator R739 [Homo sapiens],6C9H_B non-phosphorylated AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9J_B AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6PAM0|AAKB2_MOUSE	2.56e-42	111	305	63	268	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|Q9QZH4|AAKB2_RAT	1.41e-41	111	305	63	268	5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1
sp|Q5BIS9|AAKB1_BOVIN	1.93e-41	125	305	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus OX=9913 GN=PRKAB1 PE=2 SV=3
sp|P80386|AAKB1_RAT	2.71e-41	125	305	79	267	5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4
sp|O43741|AAKB2_HUMAN	4.01e-41	111	305	64	269	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RQM16519.1.