CAZyme Information: RQM15914.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM15914.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		80491.40	7.4269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000138:52434-54600(+)

Full Sequence      

MFPTTTTTTHRDSLTVSNGHFRDAQDRVRLLRGVNLSGTSKLPFGYNHTQNESNSFNRFF
ENPQNVSFINRPFPLTEASVHFARLQRWGLTFLRFIVTWEAIEHSGPGVYDHEYLQYLHD
FIAMAGDYGLSIYVDPHQDVWSRWTGGDGAPMWTLETIGLKPRNFDVTKAALCVETSGVQ
VTKFPKMIWPTNYFKMACATMFSLFWGGAKCAPSCRINGVQVQEYLQSHYLNAMVELAEA
LKGLMNVVGFGTMNEPSSGYLGLKDLAKHFHPGELKYGLAPTPFQGMALADGYEQVVQRW
SNGANQHILGRPDELVTVDPNGSRAWQQGRRCIWREEGIWDVDNTSGKPVLLRPDHFADI
RFGRDCYVPFAATQLTSCNVLVSSQRFTERIRRILPHILLFVELPPLEFSIDAFPEIDDT
LIPRAVNATHWYDGVTLFLRAWRPYFTVDPRTKRPAFGSAAVRRMHMQQLQGIKAYGHEQ
MNNAPTLIGETGIPFNMHGGKAFRNGDFSAQVGALDHTISCLEACMVSFTLWCYTSDNCN
DFGDQWNMEDLSLISKDKPRRSDGPLAIPNRDACARAIRAFVRPYATRIAGIPSKSEFLL
DRVRYELEYVSNSSMPSETSMHPTEVFVPHLQYSKGYSVETSDGYFSVQSYDGWDVVSYM
HDPSKTSHWFLITSKDTSIEKNRRARSLKMRILMSSLVALGAYTLYLIFG

Enzyme Prediction     

No EC number prediction in RQM15914.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	23	539	3.2e-173	0.9962894248608535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	7.66e-17	583	662	1	77	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
225344	BglC	0.005	82	137	79	137	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	0.009	88	139	36	88	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	0.0	1	710	1	710
AIG56220.1|GH5_12	5.15e-250	13	682	42	668
CCA13966.1|GH5_12	7.53e-250	11	693	48	751
BAJ64239.1|GH5_12	7.70e-158	18	640	7	592
QRN82755.1|GH5_12	2.55e-152	17	649	4	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	7.72e-102	20	659	27	740	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
2OSW_A	1.93e-09	89	261	79	230	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	1.93e-09	89	261	79	230	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
2OSY_A	1.03e-08	89	261	79	230	Chain A, Endoglycoceramidase II [Rhodococcus sp.],2OSY_B Chain B, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	4.08e-08	14	259	25	226	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	2.99e-115	21	633	22	628	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	1.87e-111	14	566	6	574	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	4.43e-104	17	663	9	731	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	4.31e-93	13	635	15	641	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999730	0.000325

TMHMM  Annotations     

Start	End
692	709