CAZyme Information: RQM15021.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM15021.1
• CAZy Family: GH72|GH72
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A3R7Y947]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	QKXF01000174|CGC1	90175.68	4.7153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000174:59982-62474(+)

Full Sequence      

MKVSQLFQAVVTAVAADIVMSQQGNSDQVATVHAAQEQIQGGNYHAPFSTDAPSNLFPRR
DTLTTLAPIINVASDLLTRPLPTNKWWGNLIHTTPKDIDTVANPAWSNPYALKLPKQAPY
GLQVCYSYSYRSMANEVDGVVKYYLHGFHNDVTLSATEFMSTKPDYEIYSFSDMGVRVRT
CVSGSDSCMDSALVNGMAFVSATYFGLIASIYSEHTMTMMDSSTPGKYIIQLPNKQTWVV
YSSDTSASFSIDSTGSALVASAAYTGTLRVAILPDSGDQNVYDDYSSCIIRGGNFLIESR
TTYSFQWETEGTGCNSTGLLHFALPHQVEAMKDATTAQSAGAIIVHSTTHGQMVGQVTTS
SSWTLTEDEADDEVDFYPANKPSAEMVSQINLLSTLKSDIDSDWSLNTGSWYFNGKAYQK
YASLCLMAADSSIVGDDTTLLNSCLSKLERLIEPFLSNTLGSPLVYETAYKGIVTSQVFA
ANDVNVEFGNGIYNDHHYHYGYWVTASAILKKLDPSWSGMAQLETMVWTMLRDVANPSAD
DTYFPKFRHFSWYLGHSYSHGVTPMGDGKDQESSSEDVNFSYGMMLWGKVTGNKAVEDLG
SIMLRLNARAVRTYFLMTSDNTIHPPQFVRNHVTGIFFDNKADYATWFSAEKYCIHGIQM
IPVSPINGLVRTATFVQQEWDDILSKEAIVTGADTTNPWLSLLLVNEAVINQADALAKLA
TATMDDGLSRSWALYNAASRGGLSSSSSTTVATVAPRTTTSSPTVTTVTPEAVTVTTASA
TTANSVATTDDSVTTTADSVATTATFPITLAGSGATTDTATVRSVKRNYS

Enzyme Prediction     

No EC number prediction in RQM15021.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	72	735	1.4e-178	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.74e-147	396	734	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.31e-135	48	742	61	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.69e-48	78	378	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	1	830	1	830
UIZ26440.1|GH81	0.0	1	830	1	830
UIZ26137.1|GH81	2.41e-306	44	741	122	825
UIZ26602.1|GH81	2.41e-306	44	741	122	825
UIZ26131.1|GH81	8.55e-304	44	741	12	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	4.07e-95	34	740	23	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	2.40e-94	41	740	5	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	1.27e-89	41	740	5	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.05e-27	494	686	414	605	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.94e-25	74	728	42	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.74e-103	44	742	8	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	6.74e-89	78	738	223	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	9.39e-87	49	746	407	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.80e-82	72	738	73	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	5.77e-82	42	738	426	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987818	0.012201

TMHMM  Annotations     

There is no transmembrane helices in RQM15021.1.