CAZyme Information: RQM14779.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM14779.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1695		191155.19	10.1326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000186:50038-56217(-)

Full Sequence      

MASSTTSHSNTNFPSDMWTPEIPVIIAANRLPVRLFKTKGISTKWQVEWAGDRMIESSNT
FSHYEISERATIKFVGRIPDVNVPLNEREDVEMLLRELDCYPVFLETEEAKLYYEDYCKQ
TLWPTFHNVVDVYSPVDVVLDVDAQQELTPAAQFWNPGSQKVAWQAYANVNQLFAHKICE
LYQVGDVVWIQDYHLLLTPSYIVRKIRAANVGLFLHVPFPSSEVFRTLSMRKELLRGMLN
ADHIGFHLFEYARHFMSACRRILGLSYKPILRGQLGIDYGGRRIAVTCSHMAIDTERIEN
TLARKDVRDMVVALRQKYRDKRIFAGCDTIERLKGIPSKMLAFDGFLSRCPDFINKAVLV
QKGIHRRGRVTDYLQSKKEIELVVQAINNKYRDVAKGDVVDYEEVNEFQYKERVALWRVA
DVQITTVLRDGLNTSPFEYIATHKTSPGVLIISEFSGSSRLLSGALTVNPWELDQVIDAL
RDAVYMPANEREHRRNCDFQFVSANPPRRWARSVLTDIVNARKKEESFVYMGTGFGLDFR
LMEVSTQFRKLTDQEVVPGYCTSMKRAIFLDYYRTLAPDVTKVMGVRWPDVPLSALTTLE
QLCKDPRNTVFIVSGCNCDLLTQKFGGVPGLGLVAEHGYFVRPAVLGNNARIGRPWERHG
DTMQTEGGHQRWRVKAEKIIQLYVDRTNGSTLEMRRSAVLFRYGKSDFDFGTLQAAELKE
HLEGVFEGWPLNIIQGKDYIEVRPEGVGKGKIVEHLLNKMRVDGNPADFVLCIGDDVADE
LMFDQLKQMVAHEELPKNKVFTCTVGQKPSKAEFFIDDYTDVIALLKSLKVVATKSNRNY
SLSDMQSFVRDTRPFLSSSSPGVSRVATSDSVMRKSLSRHGLQIHLTPVIEDQIVSTDVS
GHSGDRGHSPIHHRNSSKWLSRLQQFGVVAILGGILRWRSGVKNPREKKLLMYLVASLGI
ACSIQRIRSIMRRREDEDEPSRRTARYRTSPSPARDEDNEESIRNKLRESGWKKRRTEGE
NAEDAETSKDLKEKAEKDTSRGVDDHESSKILRSSRRSRSSRRREREHRSSRKKSSGSRR
RSPSRSRSIASLSQSRSRSHSRSTGRRRRHHSSSLRKRRSSRSVSRTRDEKKEDKTRKTM
EKESGKKQVMEEKENEKKERHRVSSLKKNSRRSRSGSPRSPSKSSRRRRHRHYSSYSRSR
SPPRSRRARRGGSRSRSTTRDRRSRGRNRDRRSRRRGRSYSRSRSPSYSRGHGRLERSSS
RDQPRRDANSSPEAHQHPPVTTETAPAGVGTAPLTPSAGVNPTITQLMAQYPTMSLQDII
AKMQASNVTMAAAVAQKPARELYVGNLPPNVTGPQLQEFLSTIIQQVGLTTQPGNPIVNT
WISTDGHFAFCEMRSVEECNLALLLNQLSLLGQPLKFGRPRSFMGPPQPMPQIQARTQTA
LTNLGCTPNPAWFAQPSIPSITEATADLSTLSGSTTAVVSSLKPAVTGTAVNAGSHHLIM
SNIPVVLAEDQVKELVEPFGALRSFTLVKDAATGASMGSALFEYEDEDVAVQAVEGLNGL
SIGGILLSVQRQPLASGAALGILPKAASSLEDQPSAVLKMANMISMEELRDDEEYADLAE
DVEEECKRFGNVTGLEIPRPKTGEEVPGLGCIYVCFGKKEDAASALKALNGRKFGGNIVK
VTYYPEDKFEKREFS

Enzyme Prediction     

No EC number prediction in RQM14779.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	24	518	9.6e-140	0.9642105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	6.54e-176	7	835	45	850	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	7.01e-164	24	829	3	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	6.03e-136	23	518	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215555	PLN03063	2.61e-128	24	841	13	795	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	3.31e-125	24	518	3	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	0.0	1	886	1	886
CCA16404.1|GT20	0.0	26	899	8	892
UIZ24099.1|GT20	2.64e-177	24	851	292	1140
CCA19238.1|GT20	4.43e-177	24	848	265	1095
QHO03179.1|GT20	2.42e-158	25	837	63	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	1.54e-81	24	519	13	475	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	7.49e-79	21	518	11	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.88e-77	79	492	49	436	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUT_A	4.86e-75	24	518	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	4.86e-75	24	518	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LRA7|TPS9_ARATH	1.80e-154	25	840	62	850	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O23617|TPS5_ARATH	5.72e-153	24	834	62	844	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|O80738|TPS10_ARATH	3.96e-152	25	829	62	839	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	4.77e-152	25	829	60	834	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q94AH8|TPS6_ARATH	2.69e-150	19	832	50	853	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RQM14779.1.