CAZyme Information: RQM13697.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13697.1
• CAZy Family: GH5
• CAZyme Description: Pectinesterase [Source:UniProtKB/TrEMBL;Acc:A0A3R7XGL2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36329.27	8.1352

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000241:15447-16448(+)

Full Sequence      

MRIFALPVILLASLVVGADAACTKPPAGAIIVDQSGDHSDYLTIKDAVGKLDVDTKKKQT
IFIYAGTYSEQVVISKLKSKLVLQGYTCDKMSYDKNEVMITHKMSQQDVPPHLHGSSNDL
ASTLSIDTDKVQVYNLNITNTAVPTPQNGQAPALSVACKKCAFYACSITGHQDTLFANRG
YQFYGRSHVAGTVDFIFGNARAWFESCDIESVGPGYITANGRGSKDDDSFFVLNKARVSS
SLPGKVYLGRPWGKYARVVFQQCDLGESINPAGWIPMYEDMGTSKVFLKEYKNTGQSSAI
NKRASFSKQSSDPIAISTILGEDFATFVNKNYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	312	1.9e-74	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	5.87e-53	33	307	7	275	Pectinesterase.
178504	PLN02916	5.17e-45	33	322	194	488	pectinesterase family protein
215367	PLN02682	4.01e-43	26	312	67	349	pectinesterase family protein
178051	PLN02432	8.22e-42	26	333	9	286	putative pectinesterase
215357	PLN02665	3.22e-41	30	312	70	342	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22413.1|CE8	6.45e-237	1	333	1	333
UIZ22416.1|CE8	1.01e-196	1	333	1	331
UIZ22417.1|CE8	3.62e-182	1	333	1	327
UIZ22415.1|CE8	4.90e-180	1	333	1	327
ACO54869.1|CE8	4.10e-102	1	333	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.10e-52	23	332	4	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.55e-52	23	332	4	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.80e-39	23	306	4	281	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.18e-32	31	306	6	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.50e-12	29	302	6	315	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	4.71e-69	20	332	18	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.74e-68	10	333	5	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	1.34e-63	23	332	29	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	1.65e-61	19	332	25	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.30e-60	23	332	29	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999555	CS pos: 20-21. Pr: 0.9586

TMHMM  Annotations     

There is no transmembrane helices in RQM13697.1.