CAZyme Information: RQM13478.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13478.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1238	QKXF01000255|CGC1	138089.35	4.6134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000255:14563-20116(+)

Full Sequence      

MITGEFADLYGYTCGYMYSLHPISAYHYSCRKTTDFLYTKHKDLYATMGTIPSDVKDVPW
FFESKVIEAESEVELSTNATQTLSVTHVSRPMTNHSTLADNLPVNGQTSDYSSGRFSSNI
DSSQVQRLSESGGRVSSTYGQRQTEMRLKAADFDDLPPERTKDYKGRIRTWPGLLLLLLL
VGGAAAIILQQAMETSDLISASQENYEQQQAIKRKIKDGMEDDQVLISDDGQVGNPKKYP
DMGCELPDYQSKNGEIVAVSKNGTEVPVGIKGTNWFGMETGLAIPFGLWENIDNGTSVYE
VAAFLARNNFNSVRLPLCIKNILKNVAPEKSLINMQTNRAIKISSYISTIQSIVEALGYR
HVSVLISLHTLDPKKSGGAWFSEELDVTEDEFLEAVDILTKNLCGSKYWNILGLDLKNEP
HECTWGGKAPDWQKGATLIGNRMLEGCPNWLAFVEGIASKGTITLNGIEDTYFDWWGGGL
ADAGGNPPIFDIENKLVWSPHYYNTGVNPAWYLYASGTQNAEGGRDDYVELDNKTLRNNV
EKTMEKMFGYLLKEDTNTAMVMGEFAGLYAKDVHPMLTTKRTSDYTLDVMLQENYAGAYM
WSLNPESAYQFNPADTFGHFTEGLLQDDWLTPNKVFVDGMSAMDVMKNLQLFPCFPEEKK
DSSDHRASLVVGRPGERLSTPWKIEATVVRNDQDPSSGRGAMPFTAIYSNKDHSAHKFTT
DPSQIMRLVVKKPSGSENESDYKGQHRIWPGLLLLFVLVMGSTVLIITGAMKTSETRKAR
TLHYEQRVAGKRSIKDGKTDEDIIISDDGQVGNPKSYDTSITCEMPDYQSKNGQIVAVAA
NGTEISIQIKGVNWFGMETALAVPFGLWENTDNGTTAYEIAAFLARNNFNAVRVPVSIEN
VLNNSPPQKGVINLSSNRAINGTDFISTLQTITKALAYRKIGVLISMHRLTNKKSGATWF
DEDLGVTQDDFLNAVDIISSNLCGQDYWNVMGMDLKNEPETATWGTGDDDDFVVGCEKIA
KVMHGNCPQWLGFVEGVVGVHTVTIDDEELDYYDWWGGGLQKAGDTQPEFTIENKVVWAP
HYYTTAVAPQRYFYGDKTTSDFSTYVELSDKDLLTRVEGTMYDMFGYLVNDKGYALLLGE
FAGLYTKDAHPKKTTKRTTDLTIQVLMENKYAGGFMWSLNPESEYQYNPADTEGSFTEGM
LLDDWLSPNNDFLDAFIPMDAMPNLRKFPCFPIVKEDE

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	844	1183	3.9e-147	0.997093023255814
GH5	265	607	3.1e-144	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.30e-21	841	1207	39	391	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225344	BglC	1.58e-13	262	636	39	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.74e-10	866	1183	17	272	Cellulase (glycosyl hydrolase family 5).
395098	Cellulase	3.07e-07	287	607	17	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24396.1|GH5_20	0.0	48	1238	1	1227
ABG80553.1|GH5_20	0.0	664	1233	3	575
ABG80552.1|GH5_20	0.0	664	1233	3	575
ABJ55765.1|GH5_20	0.0	664	1236	3	577
ABJ55764.1|GH5_20	0.0	664	1236	3	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.53e-42	841	1205	22	361	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	4.78e-42	841	1205	22	361	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.64e-41	841	1205	55	394	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	3.57e-41	841	1205	55	394	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.18e-40	841	1205	55	394	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.35e-28	249	634	39	372	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.45e-24	828	1205	46	377	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	4.05e-22	847	1211	42	360	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	7.92e-19	259	519	638	907	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000002

TMHMM  Annotations     

Start	End
171	193
748	770