CAZyme Information: RQM13476.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13476.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1180	QKXF01000255|CGC1	131610.48	4.7051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000255:31867-37361(-)

Full Sequence      

MTLTLMTIKRTMTLLLRSPALCRLHMRIHVSRPMTNHSTLADNLPVNGQTSDYSSGRFSS
NIDSSQVQRLSESGGRVSSTYGQRQTEMRLKAADFDDLPPERTKDYKGRIRTWPGLLLLL
LLVGGAAAIILQQAMETSDLISASQENYEQQQAIKRKIKDGMEDDQVLISDDGQVGNPKK
YPDMGCELPDYQSKNGEIVAVSKNGTEVPVGIKGTNWFGMETGLAIPFGLWENIDNGTSV
YEVAAFLARNNFNSVRLPLCIKNILKNVAPEKSLINMQTNRAIKISSYISTIQSIVEALG
YRHVSVLISLHTLDPKKSGGAWFSEELDVTEDEFLEAVDILTKNLCGSKYWNILGLDLKN
EPHECTWGGKAPDWQKGATLIGNRMLEGCPNWLAFVEGIASKGTITLNGIEDTYFDWWGG
GLADAGGNPPIFDIENKLVWSPHYYNTGVNPAWYLYASGTQNAEGGRDDYVELDNKTLRN
NVEKTMEKMFGYLLKEDTNTAMVMGEFAGLYAKDVHPMLTTKRTSDYTLDVMLQENYAGA
YMWSLNPESAYQFNPADTFGHFTEGLLQDDWLTPNKVFVDGMSAMDVMKNLQLFPCFPEE
KKDSSDHRASLVVGRPGERLSTPWKIEATVVRNDQDPSSGRGAMPFTAIYSNNDHSTHKF
TTDPSQIMRLVVKKPSGSENESDYKGQHRIWPGLLLLFVLVMGSTVLIITGAMKTSETRK
ARTLHYEQRVAGKRSIKDGKTDEDIIISDDGQVGNPKSYDTSITCEMPDYQSKNGQIVAV
AANGTEISIQIKGVNWFGMETALAVPFGLWENTDNGTTAYEIAAFLARNNFNAVRVPVSI
ENVLNNSPPQKGVINLSSNRAINGTDFISTLQTITKALAYRKIGVLISMHRLTNKKSGAT
WFDEDLGVTQDDFLNAVDIISSNLCGQDYWNVMGMDLKNEPETATWGTGDDDDFVVGCEK
IAKVMHGNCPQWLGFVEGVVGVHTVTIDDEELDYYDWWGGGLQKAGDTQPEFTIENKVVW
APHYYTTAVAPQRYFYGDKTTSDFSTYVELSDKDLLTRVEGTMYDMFGYLVNDKGYALLL
GEFAGLYTKDAHPKKTTKRTTDLTIQVLMENKYAGGFMWSLNPESEYQYNPADTEGSFTE
GMLLDDWLSPNNDFLDAFIPMDAMPNLRKFPCFPIVKEDE

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	786	1125	3.6e-147	0.997093023255814
GH5	207	549	2.8e-144	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.43e-21	783	1149	39	391	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225344	BglC	1.05e-13	204	578	39	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.56e-10	808	1125	17	272	Cellulase (glycosyl hydrolase family 5).
395098	Cellulase	2.27e-07	229	549	17	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24396.1|GH5_20	0.0	29	1180	40	1227
ABG80553.1|GH5_20	0.0	606	1175	3	575
ABG80552.1|GH5_20	0.0	606	1175	3	575
ABJ55765.1|GH5_20	0.0	606	1178	3	577
ABJ55764.1|GH5_20	0.0	606	1178	3	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.31e-42	783	1147	22	361	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	4.48e-42	783	1147	22	361	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.47e-41	783	1147	55	394	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	3.33e-41	783	1147	55	394	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.11e-40	783	1147	55	394	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.27e-28	191	576	39	372	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.28e-24	770	1147	46	377	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	3.79e-22	789	1153	42	360	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	7.37e-19	201	461	638	907	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000001

TMHMM  Annotations     

Start	End
113	135
690	712