CAZyme Information: RQM13475.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13475.1
• CAZy Family: GH5
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A3R7Y6X3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	QKXF01000255|CGC1	70245.14	6.5792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000255:37418-40306(-)

Full Sequence      

MAETHEISRPLMDRVHSTYRNSDYTHEVMDSSRLTDSGAQRDSFVYGNGPGGQRMTEMKL
LAVEPDLGAAPERTRDYKGRLRTWPGVLFLLLLVAGAVTLITINAMTVSNKTKVNDERYE
NRKRLSRKIKDGLNDDHVLISDDGQIGNPKKYPDMGCELPDYQSKKGKVYAISKNGTEVP
IGIKGLSWFGMESGLAIPFGLWENMNNGTSVYEIAAFLSRNKFNSVRLPVCITNILKNTA
PEKSLINMDTNRAINITSYITTIQTIVQALGYRKISVMLSLHTLTPRIQGGAWYSKKLGV
TQDEYLSAVDILTKNLCGPKYWNILGLDLKNEPYECTWGGKAPDWQKGSTLIGNRMLEGC
PNWLGFVEGIASQGTITLDGIEKTYFDWWGSGLADAGSDPPTFDVKNKLVYAPHYYNPGV
DPAWYLYASGTREKTGALEDYVELDNKTLKNNIEKTMEKMFGYLLTENPTSALVMGEFAG
LYSKDAHPLLTTKRTTDFQIELMLEADYAGAYMWSLNPESAYQFNPADTMGHFTEGLLED
DWLTPNKVFLDGMAPLDKIKNLKMFPCFPAKVKSDTKNKSVWAPHDHVPCVVLTYRPTRR
MHYVKLDDEILEKNVEKTMDTVFGN

Enzyme Prediction     

No EC number prediction in RQM13475.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	178	520	6.8e-144	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.85e-13	175	564	39	398	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.07e-07	200	520	17	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24403.1|GH5_20	0.0	1	579	1	579
UIZ24397.1|GH5_20	0.0	1	581	1	581
ABL75350.1|GH5_20	0.0	1	574	1	579
ABC87086.1|GH5_20	0.0	3	575	2	579
ABJ97692.1|GH5_20	0.0	1	579	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	1.26e-35	162	544	8	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.73e-35	162	544	8	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.03e-35	162	578	41	421	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	5.12e-35	162	578	41	421	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.75e-34	162	578	41	421	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.00e-25	162	558	39	383	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	8.46e-25	179	556	60	391	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	6.39e-16	180	480	644	937	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000009

TMHMM  Annotations     

Start	End
86	108