CAZyme Information: RQM13461.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13461.1
• CAZy Family: GH47
• CAZyme Description: PH domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A3M6VBQ4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1019		115198.76	7.4768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000256:15774-18833(+)

Full Sequence      

MKHNDYELHGTPSTGANDGGAGFYSQEGRPTPQKGYVDPRGPVLPPMNVSDAVGLGDQHD
NIISVHGYMHKQGKRTIKGPIHKSWKRRYFALEKAKIYYFHSHLECRQYFTTRNADLVVG
AIELKDALQLRPCARLDLPHKGFEVHTKRRVWVLCPETDEEYRMWFQGVERAIVANGAGN
IIERKLPNVRKYLMKGNQTYRFFYFLFLIAGIVELLALVFWFVIGLEPCDASRLEVDCAT
ITSTSLITLRCSSNPFSGWFTPPNWYLQIADVENVTCFRDPPIPQWVSYFAMLFAEVLTF
SLGVLYYLGMWKPVRRGAHYFDEFEPPVPDELWPKVDVLLCHYSEPAEETIDTLMACMNL
QYPPHLLQIWVLDDGYCKAKWAKGNPVPTVELNKGILETAGDLRQEVAQFMYDRVCDPNE
DTEVYAWRKLHSSANLPSPSRSKAVNRADCAVGSFRDDYRYPGLPHVTFVGRVKPDTHYS
KAGNINNCLYNEGANGRYLIILDTDMQPHPKFILATLPFFFDDEDRQDKAKYICCGIGCN
SVAKLCCASCQIAGVPEEQISYCSKDCFENAMHVQSAVHRRQVNGTMSDSRANKIDMRCM
NCDAKLGKSGVCRKCNRGTGGSDGDVVSSLHTYSDNVRDNAVAFVQTPQYFRDCIQLQIG
DPMGHRNATFYDAIQTGQDGYDCASFAGTNAMFRREALDSIGGIQYGSLTEDCYTGQVLC
SMGWKAQYFRKDFEGEPSERIRLAEGLIPDSVAGSLAQRKRWAKGNFQIALMNKKTQYFD
PEWKAPEVQVPSYHKSNKFMRRVFYYNSTLYPLGSITAILFYYITIYFLFSGYAPIYMAG
VRLVYALVPKLFVQGVLSALSNRTVDNSDVVRSQEVWFAYAFTNCTAVLEAFWWKITGKE
PKWFNTGGASRGSTAELPNVIIFIGTVVGVLWSVVRFLAGYNSIQTSHGVSLLFASLMMG
LFIAVKLAPSVRMSIQEYFGWSYESLMDQGNVLGSISIAFGLVFITLWVWIEQPTSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	629	847	2.9e-19	0.8934010152284264

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.68e-44	334	770	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	3.12e-17	638	838	366	548	cellulose synthase catalytic subunit; Provisional
404513	Glyco_trans_2_3	6.38e-14	629	843	15	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133057	CESA_NdvC_like	2.04e-13	639	772	111	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	7.14e-13	613	914	127	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24309.1|GT2	0.0	1	1019	1	1019
ABP96911.1|GT2	0.0	1	1019	10	1028
ABP96903.1|GT2|2.4.1.12	0.0	1	1019	10	1026
AEC45569.1|GT2	0.0	1	1019	10	1028
ABP96907.1|GT2	0.0	1	1019	10	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	3.72e-15	637	939	252	532	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.03e-15	637	939	264	544	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.03e-15	637	939	265	545	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.14e-13	637	821	378	540	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.55e-24	465	769	584	764	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	3.81e-15	637	769	254	380	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	3.82e-15	637	769	256	382	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.57e-14	637	769	254	380	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	2.47e-13	637	769	254	380	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

Start	End
202	224
286	308
804	826
836	858
917	939
949	971
992	1011