CAZyme Information: RQM13451.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13451.1
• CAZy Family: GH47
• CAZyme Description: Glyco_hydro_19_cat domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A425C8T1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	QKXF01000257|CGC1	28352.73	5.7344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000257:13372-14142(-)

Full Sequence      

MNLSRVIASLGLLGVAAADSGEVVKCPTEQPTTTVTPAMTTTSTSSSFSRFFDQSKFKNI
FPDAVELYNFNGLVNAASKYPTFANTGNDVNDRRELAAFFAQTAHESDNFKAAEEYAKDT
YSVWQYCDNTTYPCAPGRRYHGRGPIQLSWNYNYYNAGKALNIDLLNNPDIVAKDTAVTW
MTALWYWMTPQKNGRIIHNVVTIEGGFAQSTDIINGGLECGPDAPNKKNEEQRIKYYAKM
CEVLNVQPLGISSCNA

Enzyme Prediction     

EC	3.2.1.14:162

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	49	248	8.4e-66	0.948051948051948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	9.51e-72	54	248	3	218	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.85e-56	68	248	25	226	Chitinase class I.
225720	COG3179	2.35e-10	96	245	42	205	Predicted chitinase [General function prediction only].
381610	chitinase-like	0.002	98	189	1	75	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22871.1|GH19	8.49e-192	1	256	1	256
CCD28125.1|GH19	3.67e-130	8	256	8	260
AAN31509.1|GH19	4.04e-130	45	256	24	234
AIG55513.1|CBM1|GH19	4.23e-62	51	254	24	222
AVH63884.1|CBM50|GH19	3.39e-60	48	254	77	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V91_A	7.91e-52	68	246	29	228	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V92_A	1.12e-51	68	246	29	228	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
3WH1_A	1.41e-51	47	248	3	200	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	7.72e-51	47	248	2	199	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
2CJL_A	1.20e-49	54	254	5	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05315|CHIT_SOLTU	3.38e-48	68	248	106	307	Endochitinase OS=Solanum tuberosum OX=4113 PE=2 SV=1
sp|P52404|CHI2_SOLTU	9.83e-48	68	248	94	295	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
sp|P52403|CHI1_SOLTU	2.89e-47	68	248	96	297	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
sp|Q41596|CHI1_THECC	4.39e-47	68	246	99	298	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P24091|CHI2_TOBAC	6.66e-47	68	248	102	303	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000378	0.999574	CS pos: 18-19. Pr: 0.9672

TMHMM  Annotations     

There is no transmembrane helices in RQM13451.1.