CAZyme Information: RQM13278.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM13278.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	QKXF01000270|CGC2	59103.47	4.8044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000270:7552-9099(-)

Full Sequence      

MYDYGEDSEALLLATRVLMRSIKDSNTKYRRMVIVPQDGLQESSEKALKGDDADVEIVHT
SIPNVFAHMPLTDHRTQLMHMRNKLVIWDDPQISSLQRVVYLDPENLVLRNLDEIFACHQ
FCAVDNGQSVVYSNGLLVISPDSIAVRNLYSDAIDGFMITGREYNYIGITQGFMPGLFEA
FEESPLFFLEWDGDENEEESDELDGGDNTEEAVDNSVVLVHRLPFYYSINHMVFYERMNW
DLYKCEDKNLATGEIPGPLLSYKYSGATLKPWFWLPYTYFQVFWYWQDVRDRLGEDHFGF
FLGKVISFLVIFTFIWLAYVSLCLKLVTEPDGRQRRLSSWGLPTPGNAQPITIDVFNSRM
VRQACQFSCSVLYVVASMPLVSSVCIVVVLTLCSIYMIPITMQPSYAGKLCLIVHDLMLT
TLLLVFAVAHTLRTAQWKKDEVPATSELLLGGVWWCVKKLPLLVLTQLQFLYMIGRTDWF
QNPVLRPIMTCIFLAIALIVEGRILVVEMHRVTRN

Enzyme Prediction     

No EC number prediction in RQM13278.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.25e-15	7	174	8	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	0.0	1	515	1	515
CCA23792.1|GT8	2.31e-157	2	505	58	572
CCA16211.1|GT8	8.86e-20	2	332	54	370
UIZ21271.1|GT8	3.83e-18	12	299	54	332
QCD81290.1|GT8	5.82e-17	13	292	66	300

PDB Hits     

RQM13278.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JMI5|GUX7_ARATH	4.31e-14	13	274	77	294	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8VZP6|GUX8_ARATH	1.02e-13	13	290	81	313	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|Q8GWB7|GUX6_ARATH	1.02e-11	4	187	38	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

Start	End
305	327
369	391
406	428
448	470
485	507