CAZyme Information: RQM12471.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM12471.1
• CAZy Family: GH28
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A3M6VPU5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		89412.97	5.9590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000331:63283-65664(+)

Full Sequence      

MVQLSPRPYQNNGEAHPLLETRSTSLTQPLVNIRFSKWSVLAIISTLIFAAAVFGIFKPS
SSTMRSATTVPPDAKFDLFTPIFNAEAPPENLFKHTDEQKNLLPPKFLASGIVGSRPIPT
NDWWGNIIGATVGETQVVYPVWTNPYSVTPSLFMEPFGLTMNYPFTTRLFGGGLSGNGDA
EMWYIHGQVPEFTFSATEFSNLSHPIFEVYDWDDLSVQTRFLSRDDLSKKFEATLASGMA
FITARYSGLTPRFQTMYNISTINGFDSTEIFNRPLTNTRYVLQFGNDATWTLYFSKEVTL
HFDGHSTLNMKEPFHGTARVALIPDASAQEQNCFDQTASCVLDGGRVEAHNENAYAYKWK
TSGDCTNGMLHYAQVHHVDTLDRRFAEEADGVAAHSTTRGLMQGVVTKTSPPEWRLVESV
DFPVDFYPPRKPNAKAVEKFEMKKHLIADINSEWTIALGQSYYFNGKAAQKYASLCLMAG
DPSIVGEDDTELVLHCVKKLEGVMKPFLKNLWTNALNYDTVYRGLVSSQGFTLKDPNVDF
GNTMYNDHHYHYGYFIVTAAIINKLDPTWSGIPELNRMAGFLIRDVANPSDADPYFPKFR
SLDWYRGHSYSHGISALADGKDEESTSEDMNFYYGMTLLGKVTGDTHLETVGKLMVKLNA
RAIQTYFLIEDGNRAHPDRYRDNKVMGILFDNKVSYATWFSGEKYAIHGIQMLPATAVTE
FVRTRDFVLQEWNQVLSRESIVQNDEQTNPWLSLLYMNYATINKEFALEKLSTVTMDGGL
SRSWAMYIAATRP

Enzyme Prediction     

No EC number prediction in RQM12471.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	113	787	6.7e-175	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.61e-144	461	786	30	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	6.55e-139	39	790	16	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.44e-45	103	425	3	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	0.0	1	793	1	793
UIZ20868.1|GH81	3.53e-242	49	791	47	791
UIZ20872.1|GH81	7.07e-242	49	791	47	791
UIZ20875.1|GH81	7.07e-242	49	791	47	791
UIZ20873.1|GH81	1.42e-241	49	791	47	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.35e-110	77	793	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	8.27e-110	47	793	5	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.42e-106	77	793	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.47e-26	118	760	35	623	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.46e-24	117	780	48	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	7.48e-88	104	790	24	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.44e-88	106	790	86	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	4.90e-85	59	786	59	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	7.31e-85	117	790	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.59e-81	105	786	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000028

TMHMM  Annotations     

Start	End
38	57