CAZyme Information: RQM11575.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM11575.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		65967.91	4.8144

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000414:5700-13378(-)

Full Sequence      

MVRFVQSIFVSSVALLASFLLFNVNAADEPLPWNGLFEDLKMTTIKKKYLTHILTDRNVG
KVDPDQWLTITPNGRSPAYNGDTGVATLAVDSEAIFHEQNNFRRSELVQNVAGNTKGTTF
FRVSLMKEVAFANLKPWQAIFSESHLYELRIDASVDPVMLIWYTGGGTETRWSTEFKIKT
WYNFGIAVSSGNIDLYFSEGDDVLALAKTQSYSGDVPTNYEFHFGLLTLSDDGSPVKMVE
GKQDVLSFNGVSVEDKIPTDIGSSTPSSKESTTPANTSTSTTPAAASKTADVTPTETPSV
TATDTPTTNSSPTTSNVIADDDKPAATTLGSDASKTKNCKIRILGMVALASAYLAAPAAG
AENQPLPWSGRGNGLTPGNIEATYLTHIMTMRNNSAYNGVKNYVDIKQLGRSPAYNGDTD
VINIAVDANAIFKAQTDFRRTELVQNVETNTEGSTFFRASIMKEDAFYNNYEWQCMLTES
HNFEIRVNATASPPIIMYLNNGTWDAKWNTTFELDTWYNFGIDITKAAKGESSVITLYTS
TGDDDLKLIRKDNVVSKFASMEEFHIGLLTLSNDKSQPKMAKQKDIISFNGVSVEKKVIT
SA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	404	600	8.2e-24	0.8117647058823529
GH131	75	256	1.4e-21	0.7725490196078432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.68e-44	366	600	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.
408085	GH131_N	1.41e-38	31	259	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26845.1|GH131	0.0	1	602	1	602
UIZ26396.1|GH131	4.32e-172	343	602	7	266
CCD28226.1|GH131	6.26e-69	344	602	1	256
CCA28146.1|GH0	4.06e-22	26	269	17	265
BCS30040.1|GH131	1.36e-10	402	576	58	229

PDB Hits     

RQM11575.1 has no PDB hit.

Swiss-Prot Hits     

RQM11575.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999749	CS pos: 26-27. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in RQM11575.1.