CAZyme Information: RQM10894.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM10894.1
• CAZy Family: GH105
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		63014.22	7.7098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000510:4052-6058(+)

Full Sequence      

MTCSPSFMRRRWIVLAFAAIVIFVLLDFFFTWERLTLTAWSSSTSHFFPIRGNSTIIQTK
SDTLAQPNDFTDATIPKTTVPKVIPMKVEHNASRTASEREQIQVDDRATSRLELLESEQT
DQLELDKQLVYTLSQIIQRTTTKRGIVMPLFEKLTGLGLSLILELRAMGVSLPIEVPHCT
ELNPKTLELLQTKKELGEIRAYDICDLAANAKSATNTSRPVFCDNIDACHTKFRSFMIKP
LSIVYSQFDQILMLDADTSFFLNPTVLFDSEKFKTTGILLMHDRIGGAGHLARKAPRQPN
LSVEQEYFSTFNVTPFRPVPTLQRPKATVPNKTPVKLNFEPSDFLLSSHSFNRRASHQAD
SSQMFWNKKLQPRATVILASFLAQNDIAPPPSHGDKELFFFASELAETQYSFSDYSAGSI
GSEFEDGGPKKSTLCGILAHVFPIRQEGVPDDDVPLFSLNNKRVLIFRPDLEPFYYMKAR
PWELFPGFIGSRHLHCPFNITVGRLNESHIKHFTERRKFLEQGIHEGLGLEISLNGYYGS
QLCPYSRRGHICGMEN

Enzyme Prediction     

No EC number prediction in RQM10894.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	144	424	1e-40	0.9318181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	8.47e-25	143	441	1	272	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.009	205	269	58	111	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29124.1|GT71	0.0	1	522	1	522
UIZ29140.1|GT71	1.74e-241	1	524	1	496
UIZ29125.1|GT71	6.35e-119	125	521	93	494
UIZ28847.1|GT71	2.06e-81	143	521	38	426
CCA24247.1|GT71	2.47e-66	138	486	73	425

PDB Hits     

RQM10894.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VL7|MNN15_CANAL	1.32e-09	135	423	256	540	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|P53745|MNT4_YEAST	4.50e-09	133	440	189	470	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|Q5APQ8|MNN12_CANAL	1.50e-07	126	421	382	664	Putative alpha-1,3-mannosyltransferase MNN12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN12 PE=3 SV=2
sp|Q59YS7|MNN14_CANAL	3.17e-07	144	421	276	519	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000003

TMHMM  Annotations     

Start	End
13	32