CAZyme Information: RQM10771.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM10771.1
• CAZy Family: GH1
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A425C1R6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43214.38	6.2232

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000542:10437-11582(-)

Full Sequence      

MSTEYTHVQAKIRDGVVKSRGVNLGGWLVAEHWMTANAAFWLGIESRFANSGEYTAITKA
TSLSSIHSKLSDHHATFISESDIEQIAAAGLNTVRVPVGFWILGYDNHDPANQREWEAYT
RGTIVHLDHLIRSWAKKHNVAVLVSLHAAKGSQNGADHSSPSSPGHTFWSQYSENVANTI
EVARFLADRYLHDEAFLGIGLLNEPNGGTDEKVLYQYYMDAYRAVRLTGSDCVLSVMPML
QKQSPDEMVGFMTMPEFSNVWVEWHPYFIWGFEHTSDEQLVNVAIQRDYKERVAKWNERP
KHNRLFIGEWSLATSSNIRHNNPDLFYQFAIEQLKVHEQAEGGWTLWTWKATGDATSDVE
AWSLQKLLADDRIGNILRMSS

Enzyme Prediction     

No EC number prediction in RQM10771.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	70	354	1.8e-48	0.9747292418772563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.26e-22	20	360	19	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.15e-06	77	351	24	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	4.42e-289	1	381	30	410
UIZ29069.1|GH5	8.69e-155	2	377	42	413
CCA17636.1|GH5	7.04e-110	4	381	123	502
AAM18484.1|GH5	9.42e-106	8	370	9	365
UIZ29723.1|GH5	5.03e-104	10	370	3	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	7.44e-29	20	367	10	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.10e-28	20	367	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.41e-28	20	367	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.53e-28	20	367	16	378	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	2.89e-28	20	367	16	378	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	6.13e-37	18	370	28	387	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	1.00e-34	14	370	39	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q96V64|EXG_BLUGR	1.18e-34	18	367	36	397	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	5.09e-34	14	370	39	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	1.84e-33	20	375	43	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999822	0.000216

TMHMM  Annotations     

There is no transmembrane helices in RQM10771.1.