CAZyme Information: RQM10420.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM10420.1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1188	QKXF01000620|CGC1	137613.52	8.9790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000620:8384-12322(+)

Full Sequence      

MVERKRTLLPIYISGGSERRKIFAKRTIPSRTIDEASPVKKRKKFFQVKSRKWNVYWRLF
LITFGIGMMCLIVLGFMVQNETMSKKKGSSGESSTQSFFATWKENQMLTKLERLSHMFTA
PDDININNQKMRQTLSNLSDYECIGWRQTAKCTPLGEREDDNDKNCSAMIPNGVSGYCEV
RNIRTKEVIQVLAMRCDSLRPAVHFSCNMFPSLLSYSILSTDYEHDSNFSFAHNQEVLRT
TNQLSNTPKQSLENDGMSNETVEQFGMSFDRAIVFVIYESVLLGAYASVRSLRALGCMLP
IEMWYKTSETNVEHPLLQLMVEELNVSLRVIDDPLATGFYTKLYAIFYSAFDNVLLLDAD
NFAVRDPNYLFDTHEFLETGAIFWPDFWKPSNTIFNVQKHSYVWEFFGLDYVDMFEQESG
QVLINRRMHYKALNVLMYYGFSLPRTYETMQLVWGDKDLFRFAWLKSNSSFYMIPGPPGS
AGTKHADYDLFCGVTMVQHDPSGRVLFLHRNTQKLTTDNNQLLWTHIQQFKRTSSLFDYK
IRGANGGKAFPQFKRCFGKDVNYEKLFTLKPMSAFSFKNLETDLLRFATAGADVLRLSTY
KERDVTSTHATQCKDKKDTKRRLGNGNRTYPKTMYGVFLFIVMSCTIGLISITSLVQYGD
LQLPPRLAVHNLRSKNNQNNSMNVKKTPDYEIENEWVSSYECVGWKARRQCSPDGRPDPN
HDRACHVIVRRGDSGFCELRHKITGHVRHVMKMHCNSLRVNVKFKCEEFASLLDYGRLAT
EYVHDLNFSLANCRQQLVDDQVRATIAMNEKIKQAQGDISDKDFQKEGQIALTRPSSYKR
GITIVIYKKLLQSVYASVKSLRDMGCTLPIELWYKRSEVNVAHPLLRELTGRYGTYMREI
RDPRAVRFFTKPYAIYYSAFDQVLFLDADNFAVRDPTYLFDTPQFQNKGAIFWPDFWHFK
NSMFNIHSNSFVWEIFHLQPVDMFEQESGQVMIDRTVHQKALNVLMYYGFHPDIFLRLRL
IWGDKDLYRFAWLKTNSVFHMIDTPPGSAGLKLADKSIFCGVTMAQHDLERDVLFLHRNH
NKLSSDTYRKVWTHLQEFRMNEVHLDEYKVQGISGGQYFPSFKLCYGKDSHYENAFTVKA
IDKLPFAGLEQRLLDLVQEAARIDGTRVSDIEGKKAVNATDKAKHQGA

Enzyme Prediction     

No EC number prediction in RQM10420.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	840	1068	3.6e-49	0.9924242424242424
GT71	273	500	4.5e-48	0.9848484848484849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.99e-37	271	500	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	2.28e-34	839	1068	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	340	396	79	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	0.006	902	986	72	144	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
236884	nfrB	0.008	952	1046	380	478	phage adsorption protein NrfB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	0.0	1	1188	1	1201
UIZ24000.1|GT71	8.95e-264	604	1176	3	581
CCA25989.1|GT71	2.75e-143	135	585	90	533
CCA20051.1|GT71	1.67e-112	135	587	84	529
AIG56191.1|GT71	1.68e-100	140	590	42	485

PDB Hits     

RQM10420.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	4.16e-15	266	501	241	527	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.71e-13	837	1072	147	437	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	1.71e-13	837	1098	147	455	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AP90|MNN23_CANAL	3.09e-13	285	501	188	450	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P38069|MNN2_YEAST	9.16e-13	285	500	185	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000057

TMHMM  Annotations     

Start	End
56	78