CAZyme Information: RQM09131.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM09131.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		31989.47	6.3397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000765:12453-13328(+)

Full Sequence      

MVSSLNLAVLVAASTLAVGIAKPLQLSSGIFYSPGRHSQVTKTVIAEDLSLVAQHFSSIR
TNSAKFNDISAIAMAASASLRIGVIVSMGVPWFIDSEIQAVCDGVDQYPYTVEAVYVGSE
SLKNGDIGMYTADQIIGYINEVKKCVKGKVPVGSILRANEWLHVDTADAVAKASDLVGCN
IYPFFTPGTEPPIKKLESQWGEMLKKFGHKVRLTKTDWPHMGEKFDDNVPSKNTMQQYFD
DYRTTWSSYGKNQSYYFRAFDATEISGARYEIFTGLFDINGVPNIQLPITP

Enzyme Prediction     

No EC number prediction in RQM09131.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.16e-16	4	261	7	283	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21931.1|GH17	3.09e-207	1	291	1	291
UIZ21795.1|GH17	6.02e-136	1	202	1	202
UPT50359.1|GH17	9.58e-83	1	288	1	288
UIZ21797.1|GH17	1.12e-61	26	281	571	826
CCA18992.1|GH17	2.71e-31	29	288	22	282

PDB Hits     

RQM09131.1 has no PDB hit.

Swiss-Prot Hits     

RQM09131.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999763	CS pos: 21-22. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in RQM09131.1.