CAZyme Information: RQM09080.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM09080.1
• CAZy Family: AA17
• CAZyme Description: Dolichyl-diphosphooligosaccharide--protein glycotransferase [Source:UniProtKB/TrEMBL;Acc:A0A3M6VAL3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885		98570.59	7.7461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000769:28684-31440(-)

Full Sequence      

MTLKSKAKKAATSSSDDLNHETPVVSPTVKQIVQDPTRFVFGVDLDDPRDPEDDMNALTP
VAKFAILAMICLMSFSIRLFAVVRYESVIHEFDPYFNFRTTKYLASEGFLEFLDWFDDRA
WYPLGRIIGGTIYPGLMYTAALMYWVLNVLNISINVRNTCVFLAPLFAANTAIATYLLTK
EVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYLWIKAVHTGSMFWS
AGCALTYFYMVAAWGGYVFIINMIPIYVLVMIFAGRYTPRIYIAYSTFYTLGSLMAMQVP
FVGFNVIKQAECAGSHGVFVLLQVYCFVNWLRNYISASSFRRLVLVGASLLVSGFALALL
VLQLMGKVQWTGRSLTLLDPTYASKYIPIIASVSEHQPTPWTSYFFDLHIMVPFAPVGLY
FLFQNLTDGGIFVILYGTVAWYFAGVMVRLMLTLAPIACILGAVGISSTLRKFMGILARP
STFVVQKDGVQPVPKILALGVVTGLLFMLLSYSMHATYVSSMAYSSPSIVIEAGRTRTGE
HVIYDDYREAYFWLRQNTDDNAKIMSWWDYGYQMSAMANRTVIVDNNTWNNTHIATVGRA
LASTEEDAYPILQSLDVDYVLVIFGGVSGYSSDDINKFLWPVRIGSGVYPNDMPSERDFY
SASGNFDIGPGGSKFLHNCLAYKLCYYRFGEVMTDYQHPAGFDRARNAEVGVKNIKLTHM
EEAFTSEHWIVRIFKVKKQPNVEATTAVKTSRLSEAAAQEKDISEEKTRFLGCFTGENML
GNDRVYAGGSSGANYNLALHHAKDKGKRYFAIARVANEGHAFAFNKLPVNEASADGNDEG
CKRPCKDSNAHFCGCADAGCTDMNVSPGKGQEHNRRWAIYERLTK

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	64	695	9.7e-169	0.8556998556998557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	1.71e-110	63	525	3	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	7.50e-68	60	738	17	731	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.34e-19	64	622	1	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23018.1|GT66	0.0	1	885	1	885
CCA15036.1|GT66	0.0	52	880	51	877
CCA23157.1|GT66	0.0	52	880	51	877
AFJ69334.1|GT66	0.0	52	881	53	890
ACI33169.1|GT66	3.94e-276	63	741	19	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTG_5	2.21e-276	63	741	19	699	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	3.23e-276	63	737	19	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	6.29e-276	63	741	19	699	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	1.21e-265	63	769	73	803	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6C26_A	2.57e-214	55	738	9	684	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F1PJP5|STT3A_CANLF	5.67e-276	63	741	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
sp|P46978|STT3A_MOUSE	5.67e-276	63	741	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
sp|Q2KJI2|STT3A_BOVIN	1.14e-275	63	741	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1
sp|P46977|STT3A_HUMAN	3.23e-275	63	741	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|Q5RCE2|STT3A_PONAB	3.23e-275	63	741	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999621	0.000381

TMHMM  Annotations     

Start	End
64	83
125	147
160	179
189	208
215	237
252	274
281	303
313	331
343	365
401	423
430	448
453	475
496	518