CAZyme Information: RQM08860.1

Basic Information

• Species: Peronospora effusa
• Lineage: Oomycota; NA; ; Peronosporaceae; Peronospora; Peronospora effusa
• CAZyme ID: RQM08860.1
• CAZy Family: AA1
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A3M6VU36]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	QKXF01000784|CGC1	84259.45	6.4988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PeffusaR13	8603	N/A	0	8603

• Gene Location: location=QKXF01000784:51872-54139(-)

Full Sequence      

MYSSYESVSSCYQSTVAASPPPPIFQSTNELQKLISPHFLSREAQLRPIPTNEWWGNLLA
WDGQRESDAAFAGPYTYKIVQGQRGIIGCGLSVSYLLQYRTDGPINDNGAPRFYFYAPTI
KNWIFSAVELADHICTPPLSIQSWDDMGVHLSMAGINMYLALGSAFTTVEYHEMQVQLGT
DHGIVAINGSPARNGHQVNGTSFVISLNNGQLWVLYFFSNACGNTSLVFEDNKLTTTSKF
TGVVQAAFVLTSAMESPVPQNEHKILQLYHACAGVYPKGVTVQTLNSESFVFHWQLATAA
GSKPGSRFLHFALTHLKAMLDPCTVEEKHELVLHSHTHGPLFAYTLVTSPNSSPSWLCRV
PQAESQGVETCTAFYPPRAGSVTREEVEKMNLCHVVTKEIDENWSLPHEGSYYFKGKALQ
KFGTMCLVARHLADTTNPEIREVAQRGICKLQQLLSEFANNRSAFPLFYDTVYKGIITSE
ALTRNDMNVDFGNGVYNDHHYHYGYIVTAAAMALYLDPVWRQSADAVKVRTLVDTLIRDV
ASSSPPGSDPYFPRFRYFNWWLGHSYSHGVTPMADGKDEESTSEEVNTLYGIALYGQVTE
NAEQHALAKLMLKVYVRAVNTYFLLQNNGPRIHPAGFAKNKVTGVFFDNKCDYATWFSPN
KECIHGIQMIPVSPILEVSRSPRFVREEWDEVLSKLPIVYDWKANQSGWTSLLFANYSVV
DSAKALEVLATCPMDDGLSRAWALLYAVTRPLPSC

Enzyme Prediction     

No EC number prediction in RQM08860.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	38	746	6.8e-159	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.06e-132	395	744	13	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.56e-117	15	747	72	752	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.50e-33	39	344	5	298	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	0.0	1	755	1	755
CCA20580.1|GH81	1.27e-191	49	750	192	882
CCA20581.1|GH81	1.30e-191	49	750	192	882
CCA20579.1|GH81	1.61e-190	49	748	206	894
CCA20578.1|GH81	1.98e-180	49	733	206	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.35e-85	49	751	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.20e-85	49	751	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.57e-82	49	751	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.77e-21	413	741	340	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.15e-17	401	738	349	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.32e-82	40	747	26	699	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.30e-78	48	747	225	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.44e-70	35	747	68	734	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	1.99e-69	12	747	76	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	8.10e-65	16	747	406	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RQM08860.1.