CAZyme Information: RO3G_17395-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_17395-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59584.31	7.3138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=GG669536:2252-4134(-)

Full Sequence      

MATGENTFQLALDYHVPKNIVFSSSQGGSSHVVWVLSILEELAARGHHTIFYTRDDQTKF
IKNFPTVDLVSAGPAVATKEEMGNLIRNLTTKEPVDRLVYMLEEFSQNFTEDYLNHMDLF
SKKDVDLALCGHIMTACVEASITSKIPFIYTSVPLYSLDTSAPYINIDFLSFHNPSNKDV
SFFERLKDKVINPIHFFIKARGFIKKSQQEKMALGLETTSNPAAKLKDAIKLFNTAFGFA
PARPVGPLVELIGPIVPKTHPVLTDDLQQFLDSHQKVVYVAFGQHAVQATEELGLIMTSM
LENMETGDIDGILWSVRDMEHLFPETLQTRSGQIYRIRELFGKKEGQDILFLEWAPQVAI
LHHPSTRLFLTHGGAGSVYEALYNGVPIVVYPFFGDQPAAAVIAEENGYGRRMKKSDQEQ
AIKVVQEVLRDDRYRQNANRFKALVQIRSNHGVQRGADVVEEALYLHQDGKINHRRDVRR
DLSFLKAYNLDLYLFSLSVIFGSLFGVYRLVSYGLKRSSVKAKKFHI

Enzyme Prediction     

No EC number prediction in RO3G_17395-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	249	445	1.3e-30	0.42670157068062825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.96e-45	19	462	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.07e-33	30	524	11	498	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	9.01e-25	21	462	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	1.03e-20	226	445	242	446	ecdysteroid UDP-glucosyltransferase; Provisional
273616	MGT	6.45e-18	354	461	282	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	0.0	2	524	22	544
AOC55049.1|GT1	8.69e-83	17	512	33	530
CDS06891.1|GT1	2.87e-79	17	524	45	550
CDS11218.1|GT1	1.07e-77	18	504	42	528
CDS06902.1|GT1	3.55e-74	17	498	39	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	1.50e-13	263	444	7	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
3HBF_A	3.10e-13	269	405	265	385	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
2VCE_A	9.98e-12	241	407	235	399	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
7CJX_A	1.02e-11	287	437	16	161	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	1.66e-11	287	437	37	182	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06133|UD2B4_HUMAN	5.19e-24	30	516	34	524	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q3UP75|UD3A1_MOUSE	1.63e-23	21	504	25	500	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|Q9GLD9|UDB33_MACMU	5.58e-22	30	524	34	525	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|O97951|UDB18_MACFA	9.97e-22	30	524	34	525	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1
sp|A0A291PQG3|UGT4_DACCO	3.75e-21	10	495	16	483	UDP-glycosyltransferase UGT4 OS=Dactylopius coccus OX=765876 GN=UGT4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
493	515