CAZyme Information: RO3G_16870-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_16870-t26_1-p1
• CAZy Family: GT77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		37376.02	8.9860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476754:121361-122436(+)

Full Sequence      

MRLSLGQILIPSSLLVSLANAVSTTLHVCSSCDYTNITSALNALPNTTETWTVAIAPGNY
KEKIILTRSNVILKPSSSKGKVSIQYDSFKDTQSHVGKDSDAAVLAVRGQNVKVYDMTIA
NVFHQTRNMANLALSVEAKQVSFYGVKFYGFQDTLYVTKNSTAYFKNCHVEGSVDFIFGS
GVGYFEDCEIASNMNGGYITAHKRSSADAEGGLYFNNCKAFATLPSGPLADTKNTSMSFT
SSSQFPNSCYLGRPWNQHARVVFMNSEIGSHIKPAAWSVWQAKDPRTDGVAFYEYNNGGN
NPWNASIRANFSSLLTKSEAKQYTLKNVFKHYSWIDSRY

Enzyme Prediction     

No EC number prediction in RO3G_16870-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	330	7e-73	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.55e-39	31	327	9	293	Pectinesterase.
215357	PLN02665	3.18e-37	31	323	77	348	pectinesterase family protein
178051	PLN02432	1.66e-36	33	335	22	292	putative pectinesterase
215367	PLN02682	4.57e-36	33	335	81	367	pectinesterase family protein
178372	PLN02773	3.32e-35	31	336	14	297	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	2.34e-50	19	336	75	382
QRD05746.1|CE8	6.05e-47	32	336	434	730
CCT74155.1|CE8	9.68e-44	19	338	1089	1402
QGI68927.1|CE8	9.69e-44	19	338	1114	1427
QGI99816.1|CE8	9.69e-44	19	338	1114	1427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.43e-30	17	299	2	263	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.39e-30	17	299	2	263	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	4.09e-23	33	335	18	308	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.27e-19	33	337	14	306	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.21e-18	33	293	43	319	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9F9|PMEA_ASPFC	5.46e-31	26	299	36	288	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.46e-31	26	299	36	288	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	4.18e-30	17	299	30	291	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	7.62e-30	26	339	36	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|P17872|PME_ASPNG	2.33e-29	33	339	36	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999720	CS pos: 21-22. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in RO3G_16870-t26_1-p1.