CAZyme Information: RO3G_16253-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_16253-t26_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		49074.93	8.4506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476750:333140-334511(+)

Full Sequence      

MSGDLMARKNYKWLGFILILSTLALLSIYYTPTTNYSYYRRAVFYKDSSTTLETVNSSVM
SWTDGNGADHQIPMKLMFSKSFSFSGQSKIVPYYYKAEMDMESKDITIVTLVTRNRIPNL
ARLAKKYKGPISTTIHISDDKEGEYTLEILAQTMEKNPDMRKYVDVHIVRDEFDRELNLW
RNVAKLFARTEYVMLLDIDFYPCTNIRKNVLNNPKAMTLLESGEAALVIPAFEFSKQEDG
LDYRTFPKNKPDLIKAYKENKIEMFHSFWLPGHAPTDYDRWISVEQDDSIYQVTTYQHSY
EPYVIFKNQGSPWCDERFAGYGSNKAACLYELYVSGVSYYVLPNDFIVHQTHAYPDEARQ
VERYYNRRLYTQFREELCIRLARRFIAQKKWDDPKSENLRRECASIKPYQRAISRFV

Enzyme Prediction     

No EC number prediction in RO3G_16253-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	97	378	5.6e-49	0.827893175074184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.11e-61	105	380	1	325	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09884.1|GT49	4.58e-139	60	414	39	391
CDS10115.1|GT49	4.69e-138	62	414	77	427
CDS06289.1|GT49	1.60e-137	60	415	70	423
CDS06217.1|GT49	1.80e-136	53	413	73	431
CDS14203.1|GT49	1.74e-132	57	415	66	426

PDB Hits     

RO3G_16253-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66PG2|LARG1_DANRE	4.84e-29	94	353	463	710	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|O95461|LARG1_HUMAN	2.89e-28	94	353	462	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q9Z1M7|LARG1_MOUSE	2.89e-28	94	353	462	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	1.37e-26	94	353	462	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|Q54PG8|GNT14_DICDI	2.04e-26	106	398	348	633	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000009

TMHMM  Annotations     

Start	End
13	35