CAZyme Information: RO3G_15739-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_15739-t26_1-p1
• CAZy Family: GT49
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		86365.25	5.6496

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476748:421519-423961(+)

Full Sequence      

MSNLPIIEIEHDVHAPASTYYTTGDNARHRTRTHTGNLDPNNLNSDDKSKARRFLIDVEE
TQRKILEQEDTDGDFQITINDLGPKTMSLGTADSGGYRKIDIRGTYMLSNLLQELALAHD
YGRKHIVLDEARLNENPVDRLSRMIRHNFWDGLTRRIDADSIEVICPDPKNRSINKHPII
YVPCDDHEAYAFYKEVSESRQHLNLVVEYLPREITADYVKSINDRPGLLTLAMRKTKDEN
GRDTYVGEPFIVPGGRFNEMYGWDSYFSALGLLEDGRVEIVRSMVENFAYQIKHYGKILN
ANRSYYLARSQPPFLTDMALKVYEKLSPEKEEENKDWLRRIFKSAIKEYWEVWMCEPRLD
KKTMLSRYRPDGSGIPPETEASHFVHILEPFAEKHNVSLDEFIDKYNSGAIKEPELDEYF
LHDRAVRESGHDTSYRFDRVCANLATIDLNTLLYKYEMDIADSIRDHLDDNLEDFNGVKQ
NAQEWLERAKQRKERIDKYLWNEEESLYYDYDTIIEEQTVYESVTSFYALWAGCASQEQA
QKMVKHSLSKFEVLGGLVSGTESSRGEISLERPNRQWDFPFGWAPHQMIAWAGLEKYGMI
ETARRLAYRWLYTITKAFVDFNGVVPEKFDVVSLSHKVEVEYGNVGTDFKCVPREGFGWM
NAAYQVGLSYLTTHMRRALGTCTLPDLLFEKAMIREHRMLGMTREEEEVAALRRRTSTIA
ARAYTRNGSISAAVTRISLSDAPPKQ

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	121	669	1.4e-152	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224541	TreA	0.0	51	677	7	558	Neutral trehalase [Carbohydrate transport and metabolism].
395961	Trehalase	0.0	120	671	2	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
183934	treF	1.37e-55	248	661	160	536	alpha,alpha-trehalase TreF.
215307	PLN02567	4.60e-55	248	671	141	541	alpha,alpha-trehalase
183936	treA	6.76e-54	249	661	150	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12450.1|GH37	0.0	12	737	15	749
CDS14080.1|GH37	0.0	10	737	12	746
CDS07923.1|GH37	0.0	10	738	12	739
AAX19735.1|GH37	0.0	8	692	3	700
AAX19736.1|GH37	0.0	8	695	3	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	8.50e-270	25	702	63	751	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	2.03e-269	45	702	94	756	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	3.98e-269	57	702	6	656	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	7.42e-246	107	702	3	603	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	4.30e-44	227	661	91	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42893|TREA_SCHPO	1.90e-281	46	689	73	716	Cytosolic neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ntp1 PE=1 SV=1
sp|O42783|TREB_NEUCR	3.45e-279	10	693	19	732	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42777|TREB_EMENI	1.77e-273	33	693	74	737	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|Q757L1|TREB_ASHGO	7.41e-272	18	690	54	725	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
sp|O42622|TREB_MAGO7	1.97e-271	10	693	15	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_15739-t26_1-p1.