CAZyme Information: RO3G_15245-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_15245-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		35994.87	9.9359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:1162787-1163844(-)

Full Sequence      

MYSSLSLFALVLLCVQLASAGTINVCSSCKFKSISKAIASLPNNAESYTVLIAPGTYTEK
FTITRPNLILKPTSGIVTIQYASGHDTSSRTGSTADSAVLTIKGKNVMLENIVIANTFKQ
GKVANVALHLDAPQAYFKNVKIYGFQDTLLINRSGSGYFRNCHIEGSVDFIWGFGTGYFD
KCVIASNQRGTSVTAHGRDSVNGPGGFYFNQCVFKATVPSGPLSKTYNPSISFSSPSQFE
NTCFFARPWGKYSRVIIMNSAIGSHIKPAGWSGWSDSNPNTANVVYAEYKNGGARPWTAA
RAKFAKSLTPGEVTQYNARKVFGGDVAFFDSKR

Enzyme Prediction     

No EC number prediction in RO3G_15245-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	322	1.4e-71	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	9.96e-46	28	325	9	298	Pectinesterase.
178051	PLN02432	4.89e-42	31	324	23	288	putative pectinesterase
215357	PLN02665	2.14e-40	31	316	80	348	pectinesterase family protein
215367	PLN02682	1.27e-36	31	312	82	351	pectinesterase family protein
178276	PLN02671	4.58e-36	33	325	73	354	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	1.74e-56	31	331	91	388
QKD59401.1|CE8	5.20e-45	30	332	1167	1463
CCT74155.1|CE8	3.25e-44	30	332	1106	1402
QGI68927.1|CE8	3.25e-44	30	332	1131	1427
QGI99816.1|CE8	3.25e-44	30	332	1131	1427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.02e-28	18	301	6	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	8.08e-28	18	301	6	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	8.75e-27	31	323	18	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	1.11e-26	31	304	15	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.21e-26	31	311	19	299	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SIJ9|PME11_ARATH	5.82e-31	31	324	61	328	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
sp|Q9LUL8|PME26_ARATH	8.39e-29	32	305	672	931	Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana OX=3702 GN=PME26 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	5.07e-28	18	301	34	299	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q43043|PME_PETIN	5.71e-28	21	293	59	321	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
sp|Q9ZQA3|PME15_ARATH	9.03e-28	31	330	101	380	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999805	CS pos: 20-21. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in RO3G_15245-t26_1-p1.