CAZyme Information: RO3G_15181-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_15181-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		86434.31	6.9708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:1029024-1031783(+)

Full Sequence      

MQTLFGSCVQGYAEVFSFLLGYLSLFCWLCAQLPQMIENYKLQSADGLSLYLLYFWLAGD
LANVISCILNQQMPFQIYLAFYYCMTDIVLLFQYFYYRKNSKSYLELKTDDDVGMNERMI
VTPKYGSTDTSKRLVVLLIVFGFKAKNKTTSFSSFTVGQVLAWLCTSFYLSSRIPQIIKN
YKRHSVEGLSLALFSFAVCGNHKMKPQLNGRFIRLISLVFVIFCLCFLFRYLLKLEERNS
LLREQEEENNRLLLLKEKEEEQERRRRLEIEREQKRIKKILENRAVVEPEITLENTVDLI
HHYYIGVPTPIEPWTGDTLQLIKSPFGQRFAADLFTVPENIPDFKILTSQQRIFKSLFQY
LDPVIAEGVIDVTKDPDYKEVWSIYSKLENTLYPWIKPFWKNAFEINLTGSGKGIVMCVG
NDQFKYAATAVQAIREVHQSDIPIEIFYINSYDLSQSKRDYFESFKNLKTVDISTRINNA
YTQFGGWALKPYAMLASSFREVILMDADVYMFQKPESLFEDKGYQRTGALFFLDRTLFDN
YEDGRRWLKSFLPTYSTYVEQSRWWKTTSAHEQESGIVVMDKRKVLLGLLSTCKMNDKNE
RDKVSYRHIHGDKETFWIGYEMMQTPYAFVRSVGAVLGGLGDAGAEGTVCGNQLHLDADN
KPWWWNGGLLRDKNKWENRYLKFTHFAEGENWQFETSCIKNKDKIQELTEEEKRIGNRLI
AMDKERRKKEEEMEEEDV

Enzyme Prediction     

No EC number prediction in RO3G_15181-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	412	654	2.3e-51	0.9810606060606061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.68e-40	412	657	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
398045	PQ-loop	2.08e-18	16	76	1	61	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
398045	PQ-loop	9.91e-12	157	201	1	45	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
128923	CTNS	1.67e-06	172	201	2	31	Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins. Function unknown, but likely to be associated with the glycosylation machinery.
128923	CTNS	6.66e-05	33	61	4	32	Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins. Function unknown, but likely to be associated with the glycosylation machinery.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05902.1|GT71	4.59e-213	204	730	1	519
CDS14050.1|GT71	4.96e-186	284	731	64	518
UJR24372.1|GT71	3.01e-59	388	721	156	499
UJR24360.1|GT71	5.82e-54	338	717	102	507
EGX47386.1|GT71	9.01e-53	378	686	262	596

PDB Hits     

RO3G_15181-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38279|YPQ3_YEAST	2.34e-24	13	201	10	251	Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTC2 PE=1 SV=1
sp|Q95XZ6|LAAT1_CAEEL	4.71e-23	1	201	26	244	Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans OX=6239 GN=laat-1 PE=1 SV=2
sp|B0BMY1|LAAT1_RAT	1.41e-20	4	201	25	227	Lysosomal amino acid transporter 1 homolog OS=Rattus norvegicus OX=10116 GN=Slc66a1 PE=1 SV=1
sp|Q06328|YPQ2_YEAST	1.57e-20	7	201	2	228	Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPQ2 PE=1 SV=1
sp|Q5ZJX0|LAAT1_CHICK	1.68e-20	4	201	27	233	Lysosomal amino acid transporter 1 homolog OS=Gallus gallus OX=9031 GN=SLC66A1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000000

TMHMM  Annotations     

Start	End
15	34
47	69
74	96
211	233