CAZyme Information: RO3G_14952-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_14952-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		62138.47	8.2766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:407554-409504(+)

Full Sequence      

MKFSTLLFALLSVANCLRFGAAAGENTFQLALDYHVPKNIVFSSSQGGSSHVVWVLSILE
ELAARGHHTTFYTRDDHTKFIKNFPTVDLVSAGPALVTKEEISDILRTLLEISQKVFIER
IKKEERRLSSILLVYLEHVDFFSKHNVDLVVCDHFNEACIEASITSKIPFIYTSVPLYSL
DTSAPYINIDFLSFHNPSNKDVSFFERLKDKVINPIHFFIKARGFIKKSQQEKMALGLET
TSNPAAKLKDAIKLFNTAFGFAPARPVGPLVELIGPIVPKTHPVLTDDLQQFLDSHQKVV
YVAFGQHAVQATEELGLIMTSMLENMETGDIDGILWSVRDMEHLFPETLQTRSGQIYRIR
ELFGKKEGQDILFLEWAPQVAILHHPSTRLFLTHGGAGSVYEALYNGVPIVVYPFFGDQP
AAAVIAEENGYGRRMKKSDQEQAIKVVQEVLRDDRYRQNANRFKALVQIRSNHGVQRGAD
VVEEALYLHQDGKINHRRDVRRDLSFLKAYNLDLYLFSLSVIFGSLFGVYRLVSYGLKRS
SVKAKKFHI

Enzyme Prediction     

No EC number prediction in RO3G_14952-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	271	467	1.4e-30	0.42670157068062825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.14e-45	39	484	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.79e-32	50	546	11	498	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	8.83e-26	41	484	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	1.17e-20	248	467	242	446	ecdysteroid UDP-glucosyltransferase; Provisional
273616	MGT	3.75e-18	47	483	4	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	1.81e-313	1	546	1	544
AOC55049.1|GT1	9.10e-86	9	534	15	530
CDS06891.1|GT1	1.15e-76	10	546	13	550
CDS06902.1|GT1	2.42e-73	37	520	39	519
CDS11218.1|GT1	3.57e-72	36	526	40	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	1.58e-13	285	466	7	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
3HBF_A	3.36e-13	291	427	265	385	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
7CJX_A	1.07e-11	309	459	16	161	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2VCE_A	1.08e-11	263	429	235	399	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
6IPB_A	1.75e-11	309	459	37	182	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06133|UD2B4_HUMAN	6.27e-23	50	538	34	524	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q3UP75|UD3A1_MOUSE	1.46e-22	128	526	119	500	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|P36514|UD2C1_RABIT	3.09e-22	50	522	7	474	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	1.98e-21	41	526	25	500	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|Q6UWM9|UD2A3_HUMAN	1.14e-20	202	527	203	504	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999696	CS pos: 16-17. Pr: 0.9391

TMHMM  Annotations     

Start	End
515	537