CAZyme Information: RO3G_14936-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_14936-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	CH476746|CGC3	59396.19	8.5444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:359128-360881(-)

Full Sequence      

MTAGDNLFQLASDYHVPKNIAFSCHFGGSSHIVWVLSILDELAARGHHTTFYTRDDSAKF
TKNFPSIDLVSAGPALITKKELTDMISTVTKLKEVDMVLYMITALAQNFTKLYLEHVDFF
SKNNVDLAVCDHFNVACIEASITRKIPFVYTSAPLYSPDTSAPYVNIDFLSFHNPTSKNV
SFFARLKDKLINPIRFLIRARGFIKESQQEKRALGLEPTSDPAANIKDAIKLFNNAFGFT
PARPVGPLVEMVGPIVPKTHPMLTDDLQQFLDSHKKIVYVAFGQHAVLTTEELGLIMTSM
LENMETGDIDGILWSVRGMDHLFPKTLQTRSGQVYRIRDLFDKKEGQDILFLEWAPQVAI
LHHPSTQLFLTHGGAGSVYESLYKGIPVVVFPVFGDQHAAAVTAEENGYGRWMKKNDQDQ
ATKVVQEVLREDRYRLNANRFKALVQIRSNHGVQRGADVVEEALYLHQDGKINHRRDVRR
DLSFLKAYNLDLYLFSLSVILGSLFGVYRLISYGLQQSSGKAKKVKSA

Enzyme Prediction     

No EC number prediction in RO3G_14936-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	153	445	1.2e-29	0.6465968586387435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.21e-46	19	462	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	5.39e-31	30	525	11	499	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	5.78e-22	26	462	9	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	5.80e-17	243	445	261	446	ecdysteroid UDP-glucosyltransferase; Provisional
178170	PLN02555	3.05e-16	139	402	169	392	limonoid glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	9.66e-315	3	528	23	548
AOC55049.1|GT1	9.25e-91	17	512	33	530
CDS06891.1|GT1	1.58e-83	17	524	45	550
CDS06902.1|GT1	4.26e-82	17	523	39	543
CDS11218.1|GT1	4.58e-81	16	504	40	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VCE_A	7.90e-13	241	407	235	399	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
6IPB_A	3.63e-12	253	398	19	141	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	5.52e-12	341	398	59	120	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6JEL_A	1.80e-11	241	432	253	447	Structure of Phytolacca americana apo UGT2 [Phytolacca americana],6JEL_B Structure of Phytolacca americana apo UGT2 [Phytolacca americana],6JEM_A Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and resveratrol [Phytolacca americana],6JEM_B Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and resveratrol [Phytolacca americana],6JEM_C Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and resveratrol [Phytolacca americana],6JEN_A Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and pterostilbene [Phytolacca americana],6JEN_B Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and pterostilbene [Phytolacca americana],6JEN_C Structure of Phytolacca americana UGT2 complexed with UDP-2fluoro-glucose and pterostilbene [Phytolacca americana]
3HBF_A	3.83e-11	269	405	265	385	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06133|UD2B4_HUMAN	5.23e-24	20	500	12	501	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q3UP75|UD3A1_MOUSE	1.77e-20	112	504	133	500	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|Q8WN97|UDB30_MACFA	5.72e-20	30	500	34	501	UDP-glucuronosyltransferase 2B30 OS=Macaca fascicularis OX=9541 GN=UGT2B30 PE=1 SV=1
sp|P16662|UD2B7_HUMAN	5.74e-20	30	527	34	528	UDP-glucuronosyltransferase 2B7 OS=Homo sapiens OX=9606 GN=UGT2B7 PE=1 SV=2
sp|P36537|UDB10_HUMAN	3.21e-19	37	526	40	526	UDP-glucuronosyltransferase 2B10 OS=Homo sapiens OX=9606 GN=UGT2B10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

Start	End
493	515