CAZyme Information: RO3G_14932-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_14932-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		57487.02	7.1498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:348681-350490(+)

Full Sequence      

MKLTALSFALLTVANYISFGTAAGENTFQLALDYHVPKNIVFSAAQGGSSHVVWVLSILE
ELAARGHHTTFYTRDDHIKFIKNFPTVDLVSAGPALVEKEEFESMVRTLIAKEPVERFVY
MMEHFTQNFTEVTSTFPITPDTAAPYVNIDMLSLHNPTSKNIPFFTRLKEKVIDPIRFLI
KARSFIENYKQEHMALGLEPTSDPTAVYKDAVKLFNNAFGFAPPRPLGPLVEMVGPILPK
THPVLTDDLQQFLDSHKKVVYVAFGQHAVLTTEELGLIMTSMLENMETGDIDGILWSVRG
MDHLFPKTLQTRSGQVYRIRDLFDKKEGQDILFLEWAPQVAILHHPSTQLFLTHGGAGSV
YEALYKGVPIVVFPFFGDQPAAAITAEENGYGRWMKKDDQDQATKAVQEVLREDRYRLNA
NRFKALVQIRSNHGVQRGADVVEEALYLHQDGKINHRRDVRRDLSFLKAYNLDLYLFSLS
VILGSLFGVYRLISYGLQQSSGKAKKVKSA

Enzyme Prediction     

No EC number prediction in RO3G_14932-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	228	427	2.4e-30	0.40575916230366493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.04e-43	39	444	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	3.26e-33	185	507	201	499	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	3.45e-26	41	444	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	2.62e-19	225	427	261	446	ecdysteroid UDP-glucosyltransferase; Provisional
273616	MGT	5.40e-17	336	443	282	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	0.0	1	510	1	548
AOC55049.1|GT1	4.51e-76	37	494	33	530
CDS06891.1|GT1	2.94e-71	10	506	13	550
CDS06902.1|GT1	2.23e-68	10	505	7	543
CDS11218.1|GT1	6.10e-68	36	486	40	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBF_A	1.59e-12	251	387	265	385	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
2O6L_A	7.80e-12	328	380	67	119	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
2VCE_A	1.64e-11	223	389	235	399	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
6IPB_A	2.16e-11	235	379	19	140	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
5NLM_A	2.17e-11	224	388	235	405	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3UP75|UD3A1_MOUSE	4.62e-23	96	486	132	500	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|O97951|UDB18_MACFA	6.76e-21	50	509	34	528	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	2.80e-20	73	486	125	500	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|Q9GLD9|UDB33_MACMU	6.84e-20	50	509	34	528	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|P36510|UD2A1_RAT	1.61e-19	171	508	199	525	UDP-glucuronosyltransferase 2A1 OS=Rattus norvegicus OX=10116 GN=Ugt2a1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000409	0.999537	CS pos: 22-23. Pr: 0.9464

TMHMM  Annotations     

Start	End
475	497