CAZyme Information: RO3G_14819-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_14819-t26_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	CH476746|CGC4	31198.21	8.9444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476746:51115-51996(-)

Full Sequence      

MYLCLGYYFFKKDKYAEYAISLLEIFFINEKTRMNPNLTYAQFIRGSQNTTKTGRGEGIV
SARALCRVVNVLPVLYLFPGYHAISQHIIHWFSCYSQWLIESPVADQASKAKNNIHTWYM
AHVISVQHFLYPSSLQLTNYIKEFFEKSLPEQIDKKTGNQPLESKRAQPFHYLAFNMHAI
LFIAELARSIGIDVYHLKRDYLHLAAIYFTKFEQTKPGIDITEAARCVDIISKRICVDGC
CSRFVEYCKHSKYAEKISGPKNVICSLWL

Enzyme Prediction     

No EC number prediction in RO3G_14819-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	2	199	8.5e-54	0.6881720430107527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	7.94e-32	3	196	64	248	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA26126.1|PL38	5.59e-101	2	268	113	380
AFA26122.1|PL38	5.59e-101	2	268	113	380
CDS07499.1|PL38	5.54e-68	2	268	115	379
ABD80546.1|PL38	1.96e-29	3	195	163	349
SLM61513.1|PL38	1.61e-27	3	198	143	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.67e-19	5	196	113	301	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

RO3G_14819-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000019

TMHMM  Annotations     

There is no transmembrane helices in RO3G_14819-t26_1-p1.