CAZyme Information: RO3G_14740-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_14740-t26_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		45595.31	7.8436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476745:1033669-1034844(-)

Full Sequence      

MPSFTTFPRNQSKWGPSDWSRPALKEKDEPITQNKPTKIASTQPRFSVFGNSKSKLAMIN
SQKNEIIKERKDQPSLKKKNVKFDPLFLERVCLFNESQSPVELKGIHDKASNLRIICPNW
TSFQNRKHIRLDKKYFSVTADNQHIKGQLMVRNLALDKLVSIKYTFDRWSTIREVDGVFF
GPNPKNVTFDTYEFSLDLGHGQLADRGEMRGKIEFNIRVTAGTRDYYDDNHGKNYIIKVI
ADPLNWTKEEEEREDEYPTEEEEEEEKEKHNSFTNALKEYQHAKPFHIKICQQQQQPFLT
TRYDFSQSLSKETFQHNYFPEPFIKPSSPPSDHIHILDNMYIPSNTTPPTSPQSSPILSS
KPFLSLTPSSMDIDSSHYMNLIDKYCFYNSQ

Enzyme Prediction     

No EC number prediction in RO3G_14740-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	129	237	6.1e-21	0.9532710280373832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.09e-20	125	238	3	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	0.001	153	237	5	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ26327.1|CBM21	1.15e-11	127	243	493	612
QFZ49024.1|CBM21	1.15e-11	127	243	493	612
QFZ31995.1|CBM21	1.15e-11	127	243	493	612
QFZ43348.1|CBM21	1.15e-11	127	243	493	612
QFZ37664.1|CBM21	1.15e-11	127	243	493	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	2.63e-07	119	237	23	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40036|GIP2_YEAST	2.74e-09	145	245	439	541	GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
sp|Q7TMB3|PPR3C_MOUSE	3.51e-08	139	237	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|T1SFR8|PPR3C_CLABA	5.16e-08	137	242	145	245	Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
sp|P40187|PIG2_YEAST	2.52e-07	142	242	405	512	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	3.57e-07	139	237	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_14740-t26_1-p1.