CAZyme Information: RO3G_13319-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_13319-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		64062.32	8.8441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476743:72241-73941(+)

Full Sequence      

MGGMGTALTAIAQAQLYSGRVKPTVVMPYYSFLKKQEQYSIKSAAELATTFKNDQGEVIS
VEFKVYQMIYDFNPIPNFESLPKAEKAALVSKSLRANKTMRVYLIGPGRVYPLHKSFHAN
SVTQLYSTPRVLPQEWKDQYFNKAVATFLISRATAKHEQSLFAPVNVAPPRVDVVHLHGA
TNAYIAKYMQEFGSQKFTTTAPAVVYTMHDYLDELQYTNTLENIDKFWTNKQQNMKEFLS
PYTFGSKKAFLSPLAIDAADIVTFVSTKMAKDMVEGNLDFYLKEVVMNSLLRKAEQGQFY
GISHGIALSASTNPFTEPKLAQYGLNFTTSTKSDTKRLAKEFLIAHSKLLPEDLEKPLVL
YVGRFQYNKGLETFAEVTELFQQHNMKFAILGQPNNYPLEWVEKLAKDNEKDVILMTTVK
QQEQWLSYFRAAADFVYVPSVTESFGLVAVEGLAFGSAVISTGAGGLSEFLVDKKRNERE
FNAYLFDAQQQGSLANAVKAAADDYQQLVKSPMEYEGFVVRMMQSALRLGWDRGNEEGPV
YDYFRVYEMAMKEKKLKNRQGLKEDI

Enzyme Prediction     

No EC number prediction in RO3G_13319-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	532	1.4e-48	0.940677966101695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340822	GT5_Glycogen_synthase_DULL1-like	5.94e-23	1	548	15	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
223374	GlgA	1.94e-19	2	548	17	476	Glycogen synthase [Carbohydrate transport and metabolism].
223515	RfaB	4.73e-19	341	507	184	345	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
404563	Glyco_trans_1_4	6.52e-18	356	504	1	138	Glycosyl transferases group 1.
340831	GT4_PimA-like	2.48e-17	340	504	176	333	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06183.1|GT0	4.36e-160	1	551	167	802
CDS14426.1|GT0	1.15e-141	1	550	145	719
CDR38054.1|GT0	3.34e-86	1	551	152	805
APJ04654.1|GT5	2.97e-20	1	504	203	667
ADI37809.1|CBM48|GH13_9|GT5	2.26e-18	173	531	398	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	9.62e-10	350	504	240	389	Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
2BFW_A	1.24e-08	360	503	40	179	Structure of the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3VUE_A	1.38e-08	259	475	242	444	Crystal Structure of Rice Granule bound Starch Synthase I Catalytic Domain [Oryza sativa Japonica Group],3VUF_A Crystal Structure of Rice Granule bound Starch Synthase I Catalytic Domain in Complex with ADP [Oryza sativa Japonica Group]
3L01_A	1.49e-08	360	536	255	421	Chain A, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	1.53e-08	360	536	255	421	Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q604D9|GLGA2_METCA	4.75e-12	173	547	128	481	Glycogen synthase 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgA2 PE=3 SV=2
sp|Q2JNM6|GLGA1_SYNJB	3.44e-11	171	545	129	489	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glgA1 PE=3 SV=1
sp|Q2JSZ9|GLGA1_SYNJA	1.86e-10	171	516	129	471	Glycogen synthase 1 OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glgA1 PE=3 SV=1
sp|Q59001|GLGA_METJA	2.61e-10	353	480	294	420	Probable glycogen synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=glgA PE=3 SV=1
sp|A9NFK6|GLGA_ACHLI	4.18e-10	173	486	126	419	Glycogen synthase OS=Acholeplasma laidlawii (strain PG-8A) OX=441768 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_13319-t26_1-p1.