CAZyme Information: RO3G_12917-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_12917-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		56142.91	6.1882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476742:617522-619559(+)

Full Sequence      

MGKSIEEAYAKWRSKYLRSYGDGYFIYYKEPSEKAAEQTCSEAHGYGMLISVLKRNQQDF
DGLYRYFNQWKNHKGLMQWQQKTTSHGQFVPGDEGGDHCATDGDVDIATALFLAAKVWGR
GGAQGEIDYRAAAVNLARSIWDHCFNHETYMPLIGDWADPGDEAFALTRPSDFILSGYLL
FYYEDTERQQIWGNVVNAIVNTCQGQLAMNPQTGLIADFLTLDPRTRAYNPVHKEVLESK
HDPDYNWNSCRVPWRLGHYYMLSKDPRIRQLLETQANFFAHQLSRNSGDCPIRAGYHLNG
QPYADYSDMAFTAPVSFLFWVLDWRQQLDQVMRYIDEDNESILVFITIVLAKDLLTLTSP
TPNQSGYTPNYPNALDVYFQWTAKNDSQHMIQFTAAKGLITDSVSTKDMVYDHVWRLPSC
RFFKRYQPDQWNFNLLFQPIYAEPSNSTTNIPLGPQQSSMTMPINISVNNMTDSAAVGKG
SHHRHRQEC

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	7	318	1.8e-55	0.878125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396020	Glyco_hydro_8	7.58e-13	8	223	7	204	Glycosyl hydrolases family 8.
225940	BcsZ	5.77e-09	1	261	15	256	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11283.1|GH8	2.44e-191	3	333	2	336
AXA50804.1|GH8	9.99e-75	5	359	1	357
AYO43757.1|GH8	5.10e-71	17	359	1	345
SHO79065.1|GH8	2.25e-67	5	355	1	348
CBQ70257.1|GH8	1.09e-64	5	341	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	8.65e-44	1	314	58	359	Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1CEM_A	2.88e-28	5	316	27	309	Chain A, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	2.88e-28	5	316	27	309	Chain A, Endoglucanase A [Acetivibrio thermocellus]
1V5C_A	1.69e-24	1	314	27	335	The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.91e-24	1	314	33	341	Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19254|GUB_NIACI	4.40e-42	1	314	58	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
sp|A3DC29|GUNA_ACET2	2.54e-27	5	316	59	341	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
sp|P29019|GUN_BACSZ	3.87e-25	1	314	83	391	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
sp|P37699|GUNC_RUMCH	3.96e-21	5	313	63	339	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_12917-t26_1-p1.