CAZyme Information: RO3G_12734-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_12734-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809	CH476742|CGC4	93001.76	5.3473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476742:179168-182309(-)

Full Sequence      

MPGVVFEHRENNREIPSTLIESLVNQHILPLTGPDNTLQIPIVEDKPDWRKSATELAFRR
ALIRLVDGEETEERFKRIFDCCDIVLYCSEIDLLDQVIPLSFTEELFDLHTTEGCEKIFD
YVEQRKTRLTANMVPGKGKGLVLLRMCNELLRRLSKEINTVFCGRILMFLANSFPLGERS
GVNLRGDFNTNAIHFDTDEEVDADPTLTDEQKAFYKLFWSTRIYFANPPSVFTDNNFEDL
QKGTNGIVEKFQSIAQKEAEILGARNKEVTGTKRSRTEYMDEDDSAAEEILNQINNEYQF
PRLLSSRRLLDLEMEDARFRRSVIVQYLILFQYLSGFSQEEKERTAALLAARGTTKQSLV
QPNYVLSDEQVQWIDETREILVGLLRSIKPHGNLYTDIILTILAHERHWIIWKASGCPSF
EKPPMNINDLQKAWRTKRPRLEAPPTKYRYTFGTYEISSLYGKQNMSLSELMINRAKLPS
IVEVIDNAVTELQDSLDPPKERFNYANGALLQASRLIHDKYPHLIREVYGAKKDVYKKMY
EKMTDAPMEDTNTPDDAKPVTLANHFVIGENLTEDHLIMFINIILLCLPLSVYAVPFTKK
QIHIINQCNHHLKVGFQTNNEVKGQMIALDSNQRHSLTVSFHWAGRIWARESCDYHDCLI
AGASNPASLAEFRLSPVSSDIDYYDLSFVDGYNLPLRIEPLFESKIDHMTQSDERHCRAT
ECTRLPLCPQELQVVDDTGKFIACKSACSKYGLDQYCCTGKYSEPQLCKTNRFAREVERV
CPDSYSYAFDDDTSIYGCRSNGYNVIFCP

Enzyme Prediction     

No EC number prediction in RO3G_12734-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	606	809	9.3e-47	0.9953703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403241	efThoc1	3.97e-80	83	501	6	425	THO complex subunit 1 transcription elongation factor. The THO complex plays a role in coupling transcription elongation to mRNA export. It is composed of subunits THP2, HPR1, THO2 and MFT1. The THO complex is a nuclear complex that is required for transcription elongation through genes containing tandemly repeated DNA sequences. The THO complex is also part of the TREX (TRanscription EXport) complex that is involved in coupling transcription to export of mRNAs to the cytoplasm.
395248	Thaumatin	1.48e-68	606	809	1	211	Thaumatin family.
185757	TLP-PA	5.27e-61	601	808	1	219	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
128501	THN	9.40e-47	602	809	1	218	Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
185758	TLP-F	4.74e-28	628	809	33	229	thaumatin-like proteins: basidiomycete homologs. This subfamily is represented by Lentinula edodes TLG1, a thaumatin-like protein (TLP), as well as, other basidiomycete homologs. In general, TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. TLG1 TLP is involved in lentinan degradation and fruiting body senescence. TLG1 expressed in Escherichia coli and Aspergillus oryzae exhibited beta-1,3-glucanase activity and demonstrated lentinan degrading activity. TLG1 is proposed to be involved in lentinan and cell wall degradation during senescence following harvest and spore diffusion. TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. TLG1 from Lentinula edodes contains the required acidic amino acids conserved in the appropriate positions to possess an electronegative cleft. TLPs within this subfamily contain 13 conserved Cys residues; the number of total Cys residues in these TLPs varies from 16 in L. edodes TLG1 to 18 in other basidiomycete homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU02708.1|GH152	1.22e-38	604	809	32	253
CAB4104995.1|GH152	7.92e-37	582	808	7	236
CAG7895896.1|GH152	1.09e-36	629	809	56	250
AED93335.1|GH152	1.94e-36	629	809	57	251
BAH72278.1|GH152	1.99e-36	602	809	21	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7APK_A	1.12e-45	21	526	77	563	Structure of the human THO - UAP56 complex [Homo sapiens],7APK_I Structure of the human THO - UAP56 complex [Homo sapiens],7APK_a Structure of the human THO - UAP56 complex [Homo sapiens],7APK_i Structure of the human THO - UAP56 complex [Homo sapiens]
2AHN_A	3.33e-31	629	809	33	222	High resolution structure of a cherry allergen Pru av 2 [Prunus avium]
3ZS3_A	1.15e-28	629	809	33	222	High resolution structure of Mal d 2, the thaumatin like food allergen from apple [Malus domestica]
4JRU_A	1.75e-20	622	809	18	201	Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera]
1PCV_A	8.90e-20	646	809	44	205	Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum],1PCV_B Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96FV9|THOC1_HUMAN	3.23e-45	21	526	23	509	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1
sp|Q93VM9|THOC1_ARATH	4.27e-44	83	529	89	457	THO complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=THO1 PE=1 SV=1
sp|Q8R3N6|THOC1_MOUSE	4.83e-44	21	526	23	509	THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1
sp|Q9URT2|YJU3_SCHPO	1.68e-42	72	461	73	450	Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCP25A2.03 PE=1 SV=1
sp|P50699|TLPH_ARATH	8.04e-37	606	809	27	239	Thaumatin-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g18250 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_12734-t26_1-p1.