CAZyme Information: RO3G_11796-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_11796-t26_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	CH476740|CGC3	60437.58	7.2878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476740:1892786-1894828(+)

Full Sequence      

MRIFGAAWGAMLVPLAYGTAHNLNLSAKSCILSALMILFDNALLTISRFILLDSMLLFFT
SLSFFCLSGFRYQRDSVKWIGLFAVAFVGMYTIEDLWNMLGDLHMPKLTYIAHWMSRILC
LIIIPIAIYVASFAAHFHILRNSGPGDTMMSSLFQAGLNGSHLQSNPVQIAFGSNITIKS
FGYSGGLLHSHPHYYPDGSKQQQITCYSFKDVNNIWQVRFPRSVGDEGQPNPKVNNTFIK
YVKDGDIIRLFHLYTMRNLHSHPINAPISSKNWEVSGYGDDEIGDVQDNWRIEIVKDVNE
RNTKHVRALTTLFRLRHVYLNCLLASRHETLPEWGYKQQEVYCSRDDDLEDSSTFWSIEE
HHNEKLPPAPDNAYKSSFFQNFAHLNIVMWYSNNALIPDPDKDDILASKPTEWPMVSVGL
RMCSWDNENIKFYLMGNPSVWWPSFASIVTFSLLIIIYTIRLKRQVIDMSPARWMYFTSV
VYGIIFIVMALNFLHFAPFSFGMEGDIQQYANRRWFKHWNLIET

Enzyme Prediction     

EC	2.4.1.109:13

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	3.37e-151	1	523	112	697	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	4.53e-36	1	140	85	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	3.41e-31	380	517	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.85e-28	187	355	11	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.43e-10	239	295	1	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12794.1|GT39	1.27e-214	1	524	155	754
EGX43474.1|GT39	1.36e-163	1	521	141	733
CDS08931.1|GT39	1.97e-161	1	523	154	749
AAT44966.1|GT39	1.17e-160	1	521	146	739
BCS24754.1|GT39	9.30e-160	1	521	146	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	2.66e-143	1	523	151	755	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	2.74e-68	1	507	137	651	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQP_A	1.79e-57	164	365	17	214	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
6P28_A	5.51e-57	167	364	3	196	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQQ_A	4.42e-52	167	367	12	209	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31382|PMT2_YEAST	1.37e-142	1	523	151	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
sp|P47190|PMT3_YEAST	5.55e-137	1	523	144	748	Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT3 PE=1 SV=2
sp|Q5ADM9|PMT2_CANAL	2.71e-128	1	500	152	674	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
sp|Q9C100|PMT2_SCHPO	9.56e-128	1	521	144	737	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1
sp|P42934|PMT6_YEAST	8.17e-117	1	521	152	757	Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999844	0.000191

TMHMM  Annotations     

Start	End
4	23
30	52
79	101
118	140
440	462
474	496