CAZyme Information: RO3G_11753-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_11753-t26_1-p1
• CAZy Family: GT15|GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		86202.00	9.1442

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476740:1773620-1775989(-)

Full Sequence      

MTESEDLSSTDDSPLISPVQRSVMSSFISTFINRSSTHMKKDRKWSWWNFLSLFVLLLIL
VELIMLCTSYTLLHDERPLVTIDVQSKIEKGTRVYHVTKEFGPAVTSDLGRYVTGLAAAQ
QASGSTKVAIVMPMYSFMRKLATKTELEMAIEMRGSRPGQTIILEFRVFKMVHAFNPPVQ
APSKYEWQMINNVNTSVLITPQRLPAPTDAVPVYMISAANKRPFTQAFKSRTPEEIHDES
PVLPKEWRDQYFAKAAAAFLAHKATASDEESIFAPIRVVPRVDIVHIHGVSNAYVAKFLQ
DKKEADDLGPRPPAIIYTMHDHQDELKYANSFRSVRKFLDHPAVDREKLHKYTYGGRMFM
SKFAVDRADAVTFADHALAADVVEGRKDLYLKELVMDGLLRKAQGSRFYGINQAVDYYST
EHPFISDKLLNKSMLYPHYALDMIHDQPLLHSTDPSHPLALTIPDIPTYWTLPEQTKDFV
HVAKDKAKRFLIKRRILRNADMKRPVVLFHGKFVYDAGLESFERAAKLFVENNMRFIILG
TRKGYPFERLEAIQKRYPEHVHIISLAKDERRFGIYCRAAADFVYVPSPDPNDLALQAAE
GLVFGSAVISTGAGRMREALIDRPTDQRGNVKVIYPDPRKQTEKGATLTSYEYYNAYLYS
DQEASLAAAIADAAADYQLFIRNNKALREEFILRMIRGAISLSWDKGHYQGPVHEYNQVY
ELALKDRFIPKMRIHEVEQENELVSRLKNAQSQLV

Enzyme Prediction     

No EC number prediction in RO3G_11753-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	93	705	1.1e-27	0.972457627118644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223374	GlgA	3.54e-05	283	623	132	410	Glycogen synthase [Carbohydrate transport and metabolism].
223515	RfaB	5.15e-05	477	625	172	320	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	1.11e-04	488	625	176	311	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
234809	glgA	1.26e-04	277	588	114	364	glycogen synthase GlgA.
340822	GT5_Glycogen_synthase_DULL1-like	4.63e-04	277	588	124	376	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06183.1|GT0	1.08e-186	40	750	85	828
CDS14426.1|GT0	2.29e-142	20	727	40	723
CDR38054.1|GT0	7.48e-73	48	727	78	808

PDB Hits     

RO3G_11753-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5YG91|GLGA_THEYD	3.79e-06	283	625	146	429	Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) OX=289376 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000070

TMHMM  Annotations     

Start	End
50	72