CAZyme Information: RO3G_11661-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_11661-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		47510.79	6.1776

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476740:1523990-1525364(+)

Full Sequence      

MATESIGVQSLVIEDTGTTVPPTQNNLPLVEFIGHDLTLGTETSQGPFTGFAWLTSDMIN
ADHILTAYQDATLINGLSKKYFDMLPQQRTSKPRGVVILLGTNDKQKGYSSKDYREELVS
FLVRIRQTSLEPDAPIFVLSEPLGDMFRSSQYSVLELNRQGDQQVYFIDTTGWIKYGPTF
YHDKGHLNDAGHEMFAKRLAPFLQSKLSNPRQPLPGPIPNPNLPGDWQTMDVGDETQIGL
PGTVSADSSSTFTLWGSGADIDNDSDAFRFMYQPFSGSGAIESTIRSHSTFAKCAKAGIM
IREHLGSGSPLIMLGISPADGVFVQVRYRNFQPTKIIKKMKASPPYRLRLVRQSDDLFEA
HIQHIDILGASTAWEPFVSITFPLSKDVYAGLAVTSCDTSVVSVAKFTEVTLYHTSTLTR
VGGPRLVNQQS

Enzyme Prediction     

No EC number prediction in RO3G_11661-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	48	203	1.9e-16	0.84688995215311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	5.17e-21	30	204	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	1.14e-08	32	193	1	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	1.43e-08	92	204	48	169	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	1.19e-05	30	202	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239946	SGNH_hydrolase_like_7	2.35e-05	64	203	26	171	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATB41364.1|CBM42|CBM66|CE0	8.07e-26	9	257	134	396
ULR55324.1|CE2	7.57e-23	9	207	469	675
QYX75407.1|CE2	1.80e-22	9	207	458	664
QLD26975.1|CBM2|CE2	4.65e-22	15	213	163	370
QFY13390.1|CBM2	7.02e-22	9	215	138	350

PDB Hits     

RO3G_11661-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

RO3G_11661-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_11661-t26_1-p1.