CAZyme Information: RO3G_10569-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_10569-t26_1-p1
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	CH476739|CGC7	59408.88	4.8175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476739:921644-923439(-)

Full Sequence      

MQSLTGVLILLYLTIFQYTLAEKGTRRFEFNIQQASLNPDCFSTSYPSLTVNGQFPGPIL
RAVKNDKIEVLIKNDGNNNVSTSVHFHGIYQFGSNNADGVAGITQLPIAPGKEFLHSFQI
INQTGTFYYHSHVGVQDDTIQGPFIVYESEESLLQAEKEMLSDGQEKIQEGPYKYDEERI
LQWSEWWHQLSFDRERFYLGPNFTGDDGPDSVLLNGRSVYSNISTESCPGFTVIDLKPNR
VYRLRFIGALTFRMLGIMIPHHNMTLIEIDGEYVKPLAVDHVELVPGRRASVLIQTGDYA
DGSMFPIGSYFKYRPQDSGAFTLNGFGYIRYVSDKAHIPHIKIAHKPILLPSGIQNIADG
WVVHDLRPYYSGDPAILSAEPTHIIKLSMQLATLPDNTTRFKNNGRIHKPWGSKTESLLD
QVRNDPDFAEGAGEYNHELDKDVRTYEDPLFQDVSMQYAAPVDVIEPCGWTKIRLHLNNP
GVWPVHCHITEHMIQGKIVVFEVSPELLDDSIEDDPVEDGLVEDDD

Enzyme Prediction     

No EC number prediction in RO3G_10569-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	46	496	9e-80	0.9692737430167597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132431	ascorbOXfungal	7.18e-65	44	501	25	529	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
274555	ascorbase	4.33e-58	25	502	1	522	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	4.46e-52	7	502	6	545	oxidoreductase
177843	PLN02191	1.40e-51	3	501	1	544	L-ascorbate oxidase
259868	CuRO_2_LCC_like	2.70e-48	179	331	1	152	Cupredoxin domain 2 of laccase-like multicopper oxidases; including laccase, CueO, spore coat protein A, ascorbate oxidase and similar proteins. Laccase-like multicopper oxidases (MCOs) are able to couple oxidation of substrates with reduction of dioxygen to water. MCOs are capable of oxidizing a vast range of substrates, varying from aromatic compounds to inorganic compounds such as metals. Although the members of this family have diverse functions, majority of them have three cupredoxin domain repeats. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12532.1|AA1	8.12e-122	25	506	27	571
CDS06551.1|AA1	1.69e-119	26	509	26	646
CDS06185.1|AA1	1.06e-88	28	508	18	570
CDS07261.1|AA1	6.86e-82	22	477	19	521
QHN91254.1|AA1	6.76e-48	26	508	41	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	2.10e-43	26	506	4	526	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
1ZPU_A	7.95e-43	45	505	21	481	Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_B Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_C Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_D Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_E Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_F Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae]
5EHF_A	8.71e-39	29	500	7	464	Laccase from Antrodiella faginea [Antrodiella faginea]
5Z1X_A	2.18e-38	29	501	7	463	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
3PXL_A	3.17e-38	29	507	7	474	Type-2 Cu-depleted fungus laccase from Trametes hirsuta [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P37064|ASO_CUCPM	1.08e-42	26	506	4	526	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1
sp|P38993|FET3_YEAST	4.11e-42	2	505	3	502	Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FET3 PE=1 SV=2
sp|P14133|ASO_CUCSA	8.34e-42	16	501	26	557	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|Q40588|ASO_TOBAC	1.92e-41	8	508	14	555	L-ascorbate oxidase OS=Nicotiana tabacum OX=4097 GN=AAO PE=2 SV=1
sp|P24792|ASO_CUCMA	9.41e-41	15	506	21	556	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000184	0.999800	CS pos: 21-22. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in RO3G_10569-t26_1-p1.