CAZyme Information: RO3G_10112-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_10112-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	CH476738|CGC2	58190.98	9.1773

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476738:2352430-2354276(+)

Full Sequence      

MNHWFIITFLCILLYKAQASFLDSPSIATYWGQNSKGGSDTQHSLATYCDGNSDVIILAF
VLDFRNKELPQLNLANSCDGPRFPGTNLLQCPEVGKDIKTCQKKGKTILLSLGGAAGAYG
FANDKDAVAFADTLWATFGGGKSERRPFGDAVVDGFDLDIEGGGSTGYAAMVKRLRSHFN
SDRSKKYYITGAPQCPFPDAMLGPALDASEFDAVFVQFYNNYCSTTSGNFNFETWDQWAR
HTSPNRNVKVFLGLPGSSAAAGSGYVPYKTLEPVIRHLYSTYSSFGGVMLWDASASYSNK
EVSPHYQAAIFKLLSSLSKGGPSKGGSSKTIKNTKTISSHTTKTTKSHRPTDTPSVRECV
QKDQPCSGGFACSGNSFATCVHGRWLLRPCPEGLVCLSSTDGVSAYCAQGKAKTCTRQGS
FQALAAVDSSVAKAYTGRSVTAQFSFIGARQHRFTAILNARCLSHQAFGERVKVQLKVSQ
GIKITQVKGGTVRQQGDTVLIHYHNPIDKAMAIVIQMQGLMPTHGVFIGPSMDSIKFY

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	27	275	7.2e-27	0.7364864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.87e-118	27	310	3	278	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	9.33e-16	27	295	2	264	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	1.05e-12	30	298	6	304	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	2.39e-12	154	292	114	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
226000	Chi1	9.33e-09	93	291	86	302	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10560.1|CBM19|GH18	1.24e-157	12	537	14	568
BAA01021.1|CBM19|GH18|3.2.1.14	2.45e-144	23	537	27	539
BAA01022.1|CBM19|GH18|3.2.1.14	9.73e-139	25	537	29	541
BAA01018.1|CBM19|GH18	5.73e-116	26	537	28	492
ANB12166.1|GH18	9.94e-105	14	299	10	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	4.49e-87	24	318	5	291	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	8.62e-59	27	292	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]
4TOQ_A	9.15e-59	27	291	3	257	Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_B Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_C Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_D Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum]
1HVQ_A	1.28e-58	27	291	3	255	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
1KR0_A	7.31e-57	27	291	3	255	Chain A, Hevamine A [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29026|CHI1_RHIOL	4.36e-145	23	537	27	539	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1
sp|P29027|CHI2_RHIOL	1.73e-139	25	537	29	541	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P29025|CHI1_RHINI	1.02e-116	26	537	28	492	Chitinase 1 OS=Rhizopus niveus OX=4844 GN=CHI1 PE=3 SV=1
sp|P40954|CHI3_CANAL	3.44e-86	5	299	3	295	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P29029|CHIT_YEAST	5.27e-83	24	318	26	312	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999736	CS pos: 19-20. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in RO3G_10112-t26_1-p1.