CAZyme Information: RO3G_08089-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_08089-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41235.00	4.6349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476737:265599-267128(+)

Full Sequence      

MLAAKLNVCIETYALGHDELKPLTNKTHDPFGGWGATMVDALSTLLVMNLEDELKSVIDH
VQRIDFNVDEDVSVFESIIRYLGGFISAYDLSDQKYPILLTQAQRLANVLLPAFDTPSGL
PTHLWNPARNMSFYQDTLIAEAGTVQLELMMLSQFTQNPIYMQKAQAITDLLDNMDYGHG
MYIRGLYPTSLDVEKGRFRDDTTTFGAMGDSAFEYFLKQYLLTDGKIPQYGRMYLDSIRS
MKQHMLRQIPGYDMLLLPPYDTFRQKAENSMDHLTCFVPGMLAMGSKTFNEPEDMDIAKG
LLETCVFMYRTTKTGLSPENWYISEIERYNPITYNKTRAELERARDWWYDDGEIPTNHR

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	12	336	5.7e-100	0.7443946188340808

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.17e-125	11	349	10	355	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.14e-81	11	324	88	405	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13087.1|GH47	8.41e-146	13	350	92	430
AMJ52391.1|GH47	1.75e-78	13	346	121	451
QVM13103.1|GH47	1.63e-68	11	359	49	410
SMY22221.1|GH47	1.67e-65	17	319	123	437
SMR49523.1|GH47	1.67e-65	17	319	123	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	7.05e-49	13	319	40	349	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	8.36e-49	13	319	38	347	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	4.00e-46	13	319	23	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	4.23e-46	13	319	23	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	4.48e-46	13	319	28	331	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C512|MNS1_ARATH	6.05e-53	11	324	113	428	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	7.41e-53	11	324	114	429	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	3.75e-48	12	321	197	510	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	3.77e-48	13	324	215	531	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|P45701|MA1A1_RABIT	5.06e-48	13	319	29	338	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=MAN1A1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_08089-t26_1-p1.