CAZyme Information: RO3G_07383-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_07383-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1206		135619.65	6.7059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476736:1626650-1631138(+)

Full Sequence      

MSSLTAENVANYLPLLGQSPHIKGRIINVTHQIPYNILRAQHNDNQLPPSPPRSPCSKYT
PPSIEPTSSSDPVAAAPISKLARHHRRGNTLRMRFHAADWTVVERRGHQALYAGLQSLRK
DYETVHIGWTGPVKEQGTQKSITSNQMALEDKIKLQALLWDTGRIVPIFLDEKSHGHYEG
YCKQVLWPLFHYLVQSTSNGSLVEKSQWSDYVAVNRQFADTIIENYQPNDIIFINDYHLL
LVPEMIREKLPEAAIGIFIHATFPSSEIFRCLQTRKEILNGILGANLVGFQTYSYARHFI
SSCTRVLGCETTQVGVNHHGAQILVGTFPIGVDCNRVTQFCKQPGVLPKMDAIRDMHSGK
KIIAGRDKLDSTKGILQKLHAFETFLRNYPEWHHKVVLIQVATPTHGDHSRLEAKISETV
SHINGKYGSLQHTPIHYYHQDIDRDEYYALLSVADLALITCSRDGMNTTSFEYTLCQHQK
SEPGQLILSEFAGTAGSMGAAILVNPWDYAEVAKSMNDALVMSLDEKVTRHEQLYKHVTS
RTADFWAHSFVKQLVTVSQQQDLQSHATPTLDNQRLLDDYRTSKKRIMFFDYDGTLTPIV
AMPSDATPSLEMIRALQILCHDPNNIIWVISGRDQATLDDWIGSNIQKINLSAEHGCYIK
SVGSDGWESIVDGLDMSWKADVIEIFDYYTERTQGSFVEHKKSSITWHYRQADAEYGAFQ
AKECQNHLENAIVSKYPVEILVGKKNLEVRPMSINKGEIVKRILSKNPNADLVICAGDDK
TDEDMFRALSSIHQKASGIWPAPNAHLYSITTSMLVFYFIVTYNWPCVRLLNATSTIGCH
APKKKTGVLYQADSQQDLEDLTAHKISSDIAVLLPLELLTTDNIQQLSLYNSVIGIITLI
TNTTQASSPDSTCPNCEFGLYANDSDAHQWNQGALNLIEQNFDIPIFAIKPTDTTSRQVY
DQITKAASYNREKQYNQYPLKAVDFDLFMWAAVDSETCLRRAADDNKPIIVISANLDSRA
LFHDLVIGSTKDISGLVTVLAIADALSRAPIPSDSLQKHVLYTLFTAESWGFAGSQRFVK
DVVSDFQCTNATRAVACPYTDAPCTFPCVRNLDFKRIQFDRIETIYEFQSVSGIDSNYTN
EYYIHVDNVELNQPLLSSLQNYSNLKAAHSDGLQRKLPPSSAMSFLQQNRNIRAAVITDY
QSQFGK

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	91	554	6.9e-161	0.9494736842105264

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	99	554	18	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	111	789	30	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	0.0	99	554	23	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	0.0	120	786	132	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	8.56e-171	120	786	49	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06611.1|GT20	0.0	4	791	9	834
AJH76892.1|GT20	0.0	1	811	1	803
CDS09548.1|GT20	0.0	4	786	3	759
CDS13004.1|GT20	1.00e-287	13	789	11	733
AGJ01155.1|GT20	3.35e-258	98	792	4	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.91e-125	100	558	57	527	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HVO_A	1.91e-106	111	558	41	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.23e-104	111	554	30	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	1.83e-103	111	563	34	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.83e-103	111	563	34	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	1.03e-179	99	792	35	795	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	4.29e-174	99	789	58	770	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	1.60e-171	111	778	46	690	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9P4D3|TPS2_ZYGRO	6.04e-170	99	792	30	802	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	1.00e-164	150	792	110	753	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_07383-t26_1-p1.