CAZyme Information: RO3G_06637-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_06637-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		62436.97	7.0445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476735:3077314-3079192(+)

Full Sequence      

MWTLLRALLLISIIHCALAKTRRFEFTIQRSLLNPDCYSESYAVVTVNGQFPSPTIRVVK
DDIVQVVVKNSGENNVTTSIHFHGILQMGTNHADGVAGITQIPIAPGAKFFHQFQVRHQV
GSFLYHAHVSVEDDTVQGPFIVYESEEALLKAESEIVDNTLIRDGPYGYHGEHILQYTEW
WHQSMYDRGDYYLSPNFAGDTGPDSLLLNGKSVYNDASVDKNCAGFTILDVKPNKIYRLR
FIGGLTFRMLSINIPGHGMTLTEIDGEYVKPYPINHLELVPGQRSSVLIRTGNFTPGTTF
PITTHFAWINPAATGYTPNGYGYIRYVPDDTDHHSFVRTRIRQNPTSLPPFRNTDVHGWV
LRNLKPAFPPPPHILSSPPTRTIKLSMLQVRMPDNTTRFKNNGRVHQEWGTDTMSLLDQI
RKDPDVGKLSPLDGFSVKHQTYPMLTGEIVDIVFQNMKIAAGICVAHPWHTHGYSHYLLA
EGSGDYNHEEHKNIRTYENPLLKDVSMQYPVPEDGAIPCGWTKVRIFTDNPGVWAVHCHI
TAHMLQGKIVVFEG

Enzyme Prediction     

No EC number prediction in RO3G_06637-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	43	547	1.3e-83	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.88e-84	21	553	1	522	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	2.42e-74	1	553	2	545	oxidoreductase
177843	PLN02191	4.94e-73	1	554	5	547	L-ascorbate oxidase
132431	ascorbOXfungal	8.66e-68	39	552	25	529	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
274556	laccase	1.20e-50	19	552	1	517	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12532.1|AA1	5.91e-150	3	550	5	564
CDS06551.1|AA1	3.80e-136	2	553	6	639
CDS07261.1|AA1	2.46e-116	8	527	8	520
CDS06185.1|AA1	6.88e-114	24	553	18	564
QCD84728.1|AA1	1.76e-62	19	553	31	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	6.10e-57	19	554	1	524	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
3X1B_A	3.10e-44	28	552	31	489	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]
1HFU_A	8.31e-44	27	552	10	466	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	8.45e-44	27	552	10	466	Chain A, Laccase [Coprinopsis cinerea]
1KYA_A	5.29e-43	25	552	7	467	Chain A, Laccase [Trametes versicolor],1KYA_B Chain B, Laccase [Trametes versicolor],1KYA_C Chain C, Laccase [Trametes versicolor],1KYA_D Chain D, Laccase [Trametes versicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q40588|ASO_TOBAC	1.87e-64	19	554	28	551	L-ascorbate oxidase OS=Nicotiana tabacum OX=4097 GN=AAO PE=2 SV=1
sp|Q8LPL3|ASO_ARATH	3.40e-61	15	554	17	544	L-ascorbate oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO PE=1 SV=1
sp|P14133|ASO_CUCSA	2.30e-58	11	554	28	560	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|P24792|ASO_CUCMA	3.79e-57	19	554	31	554	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2
sp|P37064|ASO_CUCPM	3.14e-56	19	554	1	524	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999733	CS pos: 19-20. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in RO3G_06637-t26_1-p1.