CAZyme Information: RO3G_06579-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_06579-t26_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		58432.17	9.5437

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476735:2909435-2911280(-)

Full Sequence      

MRWNIPRIAAALVTTSLLLCGQSYAQERLIENYNEPKHIMFMTTFGGSSHVSWVLSILDE
LSKRGHKITYVTREFQAKHAKPYPHFNTVILDGTPTHMEKAFALKHTAILDAAGDLLHSG
YKDLQTASYAAFPDASAAYINNHLLTMKNPTTLGLSFIQRFYDMFVVPITGYIRMKPVGD
WVNKMRHLSGCNVTNHEYEPWTHMNNLKLVNSLFGIEAARPLGPLIEMVGPIMQRQYNPL
TPDLKEYLDAHSRVLYIAFGQHAVANVKDLEYILTGIMESIENGTYGGFLWASRKGAEAF
PKEIKTKSGKIYSVQDMFRGHYSNLRFATWVPQTAVVMHPSVNVFLTHGGAGSMYEGLYA
GKRFIVFPFYGDQFLNAQNVKSKGLGEYLNPEISQEEANRMIDAVGQDSDGKFQSNVNRY
KALVQIHSKNGPLRGADLVEEVLFVNSNSYLPHRYEDARQMSFIKSHNLDLIAAALSIIS
ASVYVSVTVTKKMVKRFLTRIWAKHLPDDTKTFKLKAT

Enzyme Prediction     

No EC number prediction in RO3G_06579-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.86e-34	38	397	2	364	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.12e-18	36	443	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.03e-17	323	498	322	493	UDP-glucoronosyl and UDP-glucosyl transferase.
178170	PLN02555	1.79e-14	220	422	240	444	limonoid glucosyltransferase
223071	egt	1.99e-14	220	436	261	457	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55049.1|GT1	1.15e-106	36	479	33	518
AOC55050.1|GT1	9.21e-98	4	484	2	525
CDS06902.1|GT1	2.13e-83	34	477	37	519
CDS06891.1|GT1	7.03e-82	34	496	43	544
CDS11218.1|GT1	4.27e-78	1	480	6	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JTD_A	7.33e-12	224	416	243	446	Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis],6JTD_B Crystal structure of TcCGT1 in complex with UDP [Trollius chinensis]
3HBF_A	1.58e-11	225	386	241	393	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
6LG1_A	1.72e-11	224	388	253	417	Crystal structure of LpCGTa in complex with UDP [Landoltia punctata],6LG1_B Crystal structure of LpCGTa in complex with UDP [Landoltia punctata]
6PNT_A	1.09e-10	322	419	316	410	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
6IPB_A	6.26e-10	230	384	19	151	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3UP75|UD3A1_MOUSE	2.19e-17	207	491	246	512	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|O60656|UD19_HUMAN	5.28e-17	197	486	241	503	UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
sp|Q64435|UD16_MOUSE	7.04e-17	200	485	244	503	UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
sp|Q9HAW9|UD18_HUMAN	2.19e-16	198	486	242	503	UDP-glucuronosyltransferase 1A8 OS=Homo sapiens OX=9606 GN=UGT1A8 PE=1 SV=1
sp|Q9HAW7|UD17_HUMAN	2.19e-16	198	486	242	503	UDP-glucuronosyltransferase 1A7 OS=Homo sapiens OX=9606 GN=UGT1A7 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000875	0.999112	CS pos: 25-26. Pr: 0.5141

TMHMM  Annotations     

Start	End
471	490