CAZyme Information: RO3G_06384-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_06384-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		90501.05	6.5816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476735:2369085-2371751(-)

Full Sequence      

MPGLVDAHGKKVHLNEPGRTEWEGFETGTKAAAAGGITTVVDMPLNAIPPTTTIDNLHTK
LTAAKNQCHVDVGFWGGVIPGNANQLPGLIKEGVRGFKCFLIESGVDEFPCVNEEQVRAA
MDKLANTSSVLLFHAEMEGCAHDHANPINHTYASYLHSRPQSLETNAIDMIIRVTKEYAD
QGRPVNTHIVHLSAASALPAIRAAKASGLPLTVETCYHYLNFTSETIEDGATHYKCSPPI
REAANRELLWEALLDGTIDYVVSDHSPCTAQLKNQDTGDFGTAWGGIASVQFGLPVLWTE
GRKRGVTLQKIVNWLSHSPAKRIRMDDKKGEISVGHDGDLVIWRPDAYFEVNMNDIHFKN
KLSPYIGKTFYGKSMSTILRLNKRYILLLTSFVVFIITCFILNKRHTPATPAPPLPIRDL
PSYWPTPIEQAVCKPKIYVYKAPESIQVPEQIQKEKCHESNYNSEIILHNQLTDPTSPIY
EHYVTENPEEADFFFIPFFGSCYLYNCWYENKWNWDERCEVDAKYVDPLMDMVIQEYPYW
NKTGGRNHIMIHPMDKTFTYYQSNPRFQSAIFLKTVGDKRNKWMSRHRYHRDIVIPSATR
MIHHLRANPLDYLNAQGQPKSGKRDIFALFQGCCPDVQPTDEYSNGIRSLFFNHFAHYPG
YEIGQSVADEEYLEKLSRAKYGLSPMGWTLDTTRIWEFMAFGVVPVVIADGIIEPFEFDV
DWDKFIVRIRRDEVHRLDEILKSIDDKTYEYKQKNLWEFGRRVGLEMDAWHFIVRELCRM
EGINSPVNLGLGY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT47	434	744	7.4e-49	0.9864864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238640	L-HYD_ALN	0.0	1	380	51	427	L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology). But L-HYDs differ by having an L-enantio specificity and by lacking activity on possible natural substrates such as dihydropyrimidines. Allantoinase catalyzes the hydrolytic cleavage of the five-member ring of allantoin (5-ureidohydantoin) to form allantoic acid.
163175	allantoinase	9.07e-165	1	380	50	423	allantoinase. This enzyme carries out the first step in the degradation of allantoin, a ring-opening hydrolysis. The seed members of this model are all in the vicinity of other genes involved in the processes of xanthine/urate/allantoin catabolism. Although not included in the seed, many eukaryotic homologs of this family are included above the trusted cutoff. Below the noise cutoff are related hydantoinases.
178392	PLN02795	1.46e-160	1	385	98	488	allantoinase
235732	PRK06189	4.73e-123	2	380	54	426	allantoinase; Provisional
223122	AllB	5.49e-114	1	380	52	415	Dihydroorotase or related cyclic amidohydrolase [Nucleotide transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02760.1|GT47	7.36e-241	375	793	1	417
CDR42542.1|GT47	7.50e-84	413	781	82	536
CDR42535.1|GT47	5.86e-53	513	781	64	411
QDZ20735.1|GT47	5.38e-37	436	777	125	455
UPQ99947.1|GT47	5.38e-37	436	777	125	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HM7_A	2.87e-79	1	378	58	430	Chain A, Allantoinase [Halalkalibacterium halodurans],3HM7_B Chain B, Allantoinase [Halalkalibacterium halodurans],3HM7_C Chain C, Allantoinase [Halalkalibacterium halodurans],3HM7_D Chain D, Allantoinase [Halalkalibacterium halodurans],3HM7_E Chain E, Allantoinase [Halalkalibacterium halodurans],3HM7_F Chain F, Allantoinase [Halalkalibacterium halodurans]
3E74_A	1.07e-63	2	380	73	448	Chain A, Allantoinase [Escherichia coli K-12],3E74_B Chain B, Allantoinase [Escherichia coli K-12],3E74_C Chain C, Allantoinase [Escherichia coli K-12],3E74_D Chain D, Allantoinase [Escherichia coli K-12]
1GKR_A	1.35e-41	1	380	53	429	L-Hydantoinase (Dihydropyrimidinase) from Arthrobacter aurescens [Paenarthrobacter aurescens],1GKR_B L-Hydantoinase (Dihydropyrimidinase) from Arthrobacter aurescens [Paenarthrobacter aurescens],1GKR_C L-Hydantoinase (Dihydropyrimidinase) from Arthrobacter aurescens [Paenarthrobacter aurescens],1GKR_D L-Hydantoinase (Dihydropyrimidinase) from Arthrobacter aurescens [Paenarthrobacter aurescens]
4KQN_A	1.91e-33	1	380	50	432	2.8 Angstrom Resolution Crystal Structure of D-Hydantoinase from Bacillus sp. AR9 in C2221 Space Group [Bacillus sp. AR9],4KQN_B 2.8 Angstrom Resolution Crystal Structure of D-Hydantoinase from Bacillus sp. AR9 in C2221 Space Group [Bacillus sp. AR9]
4KIR_A	1.91e-33	1	380	50	432	Crystal Structure of D-Hydantoinase from Bacillus sp. AR9 in C2221 space group [Bacillus sp. AR9],4KIR_B Crystal Structure of D-Hydantoinase from Bacillus sp. AR9 in C2221 space group [Bacillus sp. AR9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32375|ALN_YEAST	4.49e-123	1	380	63	435	Allantoinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAL1 PE=1 SV=2
sp|Q9RKU5|ALLB_STRCO	6.62e-121	1	380	56	424	Allantoinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=allB PE=3 SV=1
sp|Q54SV3|ALN1_DICDI	1.41e-115	1	420	59	486	Probable allantoinase 1 OS=Dictyostelium discoideum OX=44689 GN=allB1 PE=3 SV=1
sp|Q55C91|ALN2_DICDI	2.03e-115	1	383	90	484	Probable allantoinase 2 OS=Dictyostelium discoideum OX=44689 GN=allB2 PE=3 SV=1
sp|Q82LL4|ALLB_STRAW	2.25e-114	1	380	56	423	Allantoinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=allB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_06384-t26_1-p1.