CAZyme Information: RO3G_06305-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_06305-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		30884.20	6.9280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476735:2185254-2186036(-)

Full Sequence      

MATLVTYNRFKVLSRLASHYKGPISAAIHVNDDHTKEHIIKDLHQLYADNPDMGRYVDLH
LVIDNFDRQFNMWRNVAKFFARTNYIMMLDVDFYLCTDFRKSLKKQPHLMELLRSGKGAI
VVPAFEYIDESDGEDWNVFPKTKQELLVDVEAEKLDMFHRSWKRGHGSTNYEKWYKQTKP
YKVTEYNYSYEPYVIFKKEGTPWCDERFVGYGANKAACLFEIYLAGIDYWVLPDDFLIHQ
THHYPEDTRAKEVFLLAYKT

Enzyme Prediction     

No EC number prediction in RO3G_06305-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	3	247	6.4e-43	0.712166172106825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.06e-51	1	252	4	306	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06289.1|GT49	1.46e-157	1	252	119	370
CDS14203.1|GT49	2.99e-148	1	252	122	373
CDS09884.1|GT49	1.33e-138	1	252	88	339
CDS08021.1|GT49	5.25e-133	1	256	23	279
CDS06217.1|GT49	4.98e-129	1	252	129	380

PDB Hits     

RO3G_06305-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O95461|LARG1_HUMAN	1.18e-27	5	242	480	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q5XPT3|LARG2_MOUSE	1.52e-27	5	242	409	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q66PG3|LARG1_CHICK	4.02e-27	5	242	480	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Gallus gallus OX=9031 GN=LARGE1 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	5.46e-27	5	242	480	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	1.30e-26	5	242	408	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_06305-t26_1-p1.