CAZyme Information: RO3G_05550-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_05550-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	CH476735|CGC4	35548.00	6.6424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476735:73283-74564(-)

Full Sequence      

MVDGHLPTWENASHVEKELPQLVSAAHKEGAKVLTSLGGWTGSITFRYKTDGIDIDWEYP
GRQGAGCNTVDEDNDVDNFLKLLKELRQEVDKQFKSNKKEITIAASVSLLKSNVSDFAHV
LDRVNVMTYDINGAWNEQTGPNSPLYAPEGSFSFSSAIEGWIKAGIPTNKIAGGIAFYGR
STTAKENMLKTKSIYQDQVKSVVPKGDSKDTTQSDAYCPADNGAYSGTWRFNHLLSEGVL
STPLKAKLPWVRTWDNSTATPWLFNPKTKTFLTYDDPESIAKKACYSLKKDLAGVMIWSV
DQDTDKLDLLNAAYKIRNGKC

Enzyme Prediction     

No EC number prediction in RO3G_05550-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	22	307	2.8e-53	0.7905405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.72e-63	32	303	86	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	3.11e-62	25	303	61	334	Glyco_18 domain.
395573	Glyco_hydro_18	1.92e-57	3	303	37	307	Glycosyl hydrolases family 18.
225862	ChiA	8.30e-55	31	312	127	431	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	6.17e-49	32	303	72	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13735.1|GH18	2.10e-116	1	319	63	411
AMP42675.1|GH18	2.37e-113	1	319	69	420
AJD76187.1|GH18	4.00e-113	1	318	36	386
CDS06898.1|GH18	3.58e-87	6	318	67	413
QDJ94321.1|GH18	2.19e-82	16	310	65	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.65e-46	10	317	37	369	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	6.57e-31	32	306	124	409	Chain A, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	1.56e-30	8	303	132	448	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6JM7_A	8.47e-30	32	303	77	350	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
5GZU_A	4.00e-29	26	314	105	388	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.12e-29	32	306	156	441	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P41684|CHIT_NPVAC	8.50e-27	32	315	257	546	Chitinase OS=Autographa californica nuclear polyhedrosis virus OX=46015 GN=CHIA PE=1 SV=1
sp|P07254|CHIA_SERMA	3.08e-26	32	313	267	555	Chitinase A OS=Serratia marcescens OX=615 GN=chiA PE=1 SV=3
sp|Q9W092|CHIT2_DROME	1.86e-23	43	303	153	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|O10363|CHIT_NPVOP	3.38e-23	32	312	256	539	Probable endochitinase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus OX=262177 GN=ORF124 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000021

TMHMM  Annotations     

There is no transmembrane helices in RO3G_05550-t26_1-p1.