CAZyme Information: RO3G_04723-t26_1-p1

Basic Information

• Species: Rhizopus delemar
• Lineage: Mucoromycota; Mucoromycetes; ; Rhizopodaceae; Rhizopus; Rhizopus delemar
• CAZyme ID: RO3G_04723-t26_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		101159.27	6.5149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RdelemarRA99-880	17703	246409	244	17459

• Gene Location: location=CH476734:1381305-1383959(-)

Full Sequence      

MTRPTAERRLSMPKLTRRLTNVVIHVDKENEGNIEPVASASVPSHTSKHIKLKEDTLQEW
KRHMPPKENDPEAIKRDIVHHAVETLCRGPNNLDRLAVYQAAALAVRDRLLADWNRTEEL
MKAKNPKRCYYLSMEFLIGRALDNALHCLKMKEAYRQGVQDLGFRLEDLLEQERDAALGN
GGLGRLAACYMDATATLDYPTWGYGLRYQYGIFKQLINKEGYQTEMPDYWLDPNINPWEF
PRNDVLYEVQFYGYVATKMNDKGESRMSWEGGQKVQAMAYDVPIPGFGTQGCGNIRLWSS
KSFNTFDFASFNEGDYDRSVADQKNAENLTSVLYPNDNHLVGKELRLRQEYFFVSASLQD
IIHRFKRTNAAWKDFPDKVAVQLNDTHPTLAIPELQRILIDVEGLDWDDAWDIVTRVFAF
TNHTVLPEALERWSVPMMEHILPRHMQIVYDINLFFLQNVEKKYFGDRELLNRVSIIEES
NPQQVRMAYLAVVGSHKVNGVAALHSDLVRSQLFPDFVRYYGPEKFMNITNGITPRRWLY
QANPGLRDLITQTLGSEQWVTDLNALKALKAWADQAEFQEKWMQVKAKNKQRLADWIKSH
LNISVNPEALFDIQVKRIHEYKRQFMNILSVVYRYKNIKLLSDEERKELVPRVVIFGGKS
APGYYIAKMVIKLINTVAEVVNNDPSIHDLLKVVYIPDYNVSLAEIIVPASDLSQHISTA
GTEASGTSNMKFVLNGGLILGTVDGANIEIRSEIGEDNIFLFGTLADQVADIRHRQKYHG
VLIDPNLQVVLQAIQSGEFGESASVFGPLINTLTYGGDYYLISADFEKYLDAHDQVEVVY
KDRQAWAKKSILCTAGMGFFSADRATREYAEKVWQLEQVSIKNA

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	159	876	4.1e-275	0.9955489614243324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	72	879	15	813	glycogen phosphorylase; Provisional
223136	GlgP	0.0	70	877	5	749	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	99	875	35	795	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	78	876	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	75	876	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX46445.1|GT35	0.0	47	881	37	873
BCS26059.1|GT35	0.0	52	881	51	877
APA13713.1|GT35	0.0	52	880	52	877
CCD47155.1|GT35	0.0	52	880	52	877
ATZ57832.1|GT35	0.0	52	880	52	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	13	880	1	879	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	1.66e-280	66	877	55	869	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
5LR8_A	7.36e-258	70	879	28	923	Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LR8_B Structure of plastidial phosphorylase Pho1 from Barley [Hordeum vulgare subsp. vulgare],5LRA_A Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRA_B Plastidial phosphorylase PhoI from barley in complex with maltotetraose [Hordeum vulgare subsp. vulgare],5LRB_A Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare],5LRB_B Plastidial phosphorylase from Barley in complex with acarbose [Hordeum vulgare subsp. vulgare]
1FA9_A	2.79e-250	74	882	27	833	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1XOI_A	2.79e-250	74	882	27	833	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00766|PHS1_DICDI	0.0	69	882	39	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P06738|PHSG_YEAST	0.0	12	880	23	902	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|P34114|PHS2_DICDI	4.36e-297	70	878	110	909	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	2.78e-280	66	877	22	836	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P32811|PHSH_SOLTU	1.21e-275	66	881	18	837	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RO3G_04723-t26_1-p1.